/usr/lib
NameSizeModeActions
anaconda-runtime/-0755rm
ConsoleKit/-0755rm
cups/-0755rm
exim/-0755rm
games/-0555rm
gcc/-0755rm
gconv/-0755rm
java/-0755rm
java-1.3.1/-0755rm
java-1.4.0/-0755rm
java-1.4.1/-0755rm
java-1.4.2/-0755rm
java-1.5.0/-0755rm
java-1.6.0/-0755rm
java-1.7.0/-0755rm
java-1.8.0/-0755rm
java-ext/-0755rm
jvm/-0755rm
jvm-commmon/-0755rm
jvm-exports/-0755rm
jvm-private/-0755rm
krb5/-0755rm
locale/-0555rm
lsb/-0755rm
openssl/-0755rm
oracle/-0755rm
python2.6/-0755rm
rpm/-0755rm
systemd/-0755rm
yum-plugins/-0755rm
.libcrypto.so.1.0.1e.hmac650644editdlrm
.libcrypto.so.10.hmac650644editdlrm
.libssl.so.1.0.1e.hmac650644editdlrm
.libssl.so.10.hmac650644editdlrm
libcrypto.so.1.0.1e18622640755editdlrm
libcrypto.so.1018622640755editdlrm
libdb-4.7.so15313560755editdlrm
libffi.so.5238280755editdlrm
libffi.so.5.0.6238280755editdlrm
libform.so.5577080755editdlrm
libform.so.5.7577080755editdlrm
libformw.so.5627000755editdlrm
libformw.so.5.7627000755editdlrm
libfreebl3.chk8990644editdlrm
libfreebl3.so96000755editdlrm
libfreeblpriv3.chk8990644editdlrm
libfreeblpriv3.so5217800755editdlrm
libgdbm.so.2248760755editdlrm
libgdbm.so.2.0.0248760755editdlrm
libhistory.so.6311360755editdlrm
libhistory.so.6.0311360755editdlrm
libkdb5.so.6717160755editdlrm
libkdb5.so.6.0717160755editdlrm
libmemusage.so177520755editdlrm
libmenu.so.5280880755editdlrm
libmenu.so.5.7280880755editdlrm
libmenuw.so.5287600755editdlrm
libmenuw.so.5.7287600755editdlrm
libpanel.so.5102680755editdlrm
libpanel.so.5.7102680755editdlrm
libpanelw.so.5102680755editdlrm
libpanelw.so.5.7102680755editdlrm
libpcprofile.so78920755editdlrm
libpython2.6.so.1.015281720555editdlrm
libsqlite3.so.05854360755editdlrm
libsqlite3.so.0.8.65854360755editdlrm
libssl.so.1.0.1e4193800755editdlrm
libssl.so.104193800755editdlrm
libtic.so.5733920755editdlrm
libtic.so.5.7733920755editdlrm
libverto-k5ev.so508760755editdlrm
libverto-k5ev.so.0508760755editdlrm
libverto-k5ev.so.0.0508760755editdlrm
libverto.so178360755editdlrm
libverto.so.0178360755editdlrm
libverto.so.0.0178360755editdlrm
php.ini383650644editdlrm
sendmail10480755editdlrm
Edit: /usr/lib/libpython2.6.so.1.0 (1528172B)
ELF4L4 (M$$PtdZZQtdGNU;q?-=K5 ȅUtw HIdK20((#8 L"@0P!@@)CzD  $a r *@( !@x40DaJ1a@@,%"@ ;K<@H0` E"" .` X@CC a`   H3hE<8(P! u`2A@@$M)CH0B l@H ([D B !  0 Ȁ@BCPPBR41(BMHHAD HbX`6b HB*Ap(Ba $q%zhA 0D H 5iA @40Y@ b` p2 @JGE",PBu`3i ,0@h@@!$a` \#T@p+`+%P RG/ ѱNȈ"b DKD@@$"h"@AP HH1P@*0*5@@EA̐pDA @B(  " HA A" 7@0ENP(P[""G`4BH    hBHD `($8"(@@D@dI ABAPa@@!1H @\!-*3@ X$@ 0,~0   H@*H!h }   !#%(*,/14569:;=>?ABDEGHKLMPQSTVWXY\^_`abdefhklmopstxz{|}      !"#%'()*+-/256789;<=>?ACEFIJKLMOPQSUVWXY\]^`cdefgjlmopsvwyz|}~    "$%'()+-.02469:;<>?@ACGKLMNOPQRSTUVWZ]`bfghilnopqrstuwxz|~    #%'()*+,-/0258:;=?@ABDFGHILNPQRWXZ[^_`adfgikloprsuvwxy|~   !#%()+-/12579:<=?BCDGIJKNPRTVWXYZ[]^`dfjkmnoqrst8(.}WI)guD[oP"PwybPС9 Ims%8=T?bD:#^Xْ_=ם@ ].VKxd}bmN15NTڸ9`/M8=Œ $BdWwWSGd;L'ŶyYEJq,VxD)ھ}+eW>oǠ#>wMC jXn -i=٧@2OAR DgPV5 %zI7#h)"SGdn`t1"F]w ilvZPbr楗~'V qNh6txB\ȡ^VN8{͜Pr`o [L!} xuͱʵrR º*p˛d꒑s/w<@R4r~MөApZ-[Ch}dtE!@MGCESa9^~k@ GV@K`%ziޤtTtQLbߺKOL ,e y(U$ş䎣E}RG3}rݲ׻eQ~ 3I)~Eӧk@rl?dWqG78]?QLǺ^/c7sLf'#z({ߗÃkqȻ uĿ*h*m΀* 8]-ϊ0-Anx*Hu?lZv #qHvF`TqccxƑԈ+|˭B(qWX?(3ܓ,Ꞌbن=s=,vE3!^4FI 8 eۺ)'~§ _w@3ԥ}6HIڬWZ`5ԟܚqrW=WW,ۿ̰ɩ6y#;N%N(2 R[AN:V,d|dk5y_VNTGt2ĥFβ "QCdáZ\^wg'i7(}lX fm:V;I ֌>`'a 1{܋ )J>VT?0xtNBg{63oQڕ}+3j{/۞U&rðI{}F >5ERK$ =>F7 p?YDֳW"Y~*UFkZKN<@cՍNuao҃;τ[aynqW%.e[G6i@SxFzmW cy_n I Ng#/KusW(8fr 'U ?*ɳ)Mظ@GsqXH'b?QPҔF$H "!sN7NNSH@F")P!l5g%$]U=LRha\F 38WI)YW.XBꁃ2XFE+UK䧽Q:Zl7SQ1mOpgС]<'op--R*u_(5s[dq"@y("kJYG1ؑ~Z!/UR1Zƛ d9ƨe)`ˎ TG\P{Q;j^\e96w@pB 8Aĭ 'BpVm {LCijg ҢKj]C(N#OUWqwm;2VJ9)Q2mvnr 'nx)!k`W{ UIimlz!jT , `p>`-GoRIiw'GKBoPI 2 ,49 bS&#/Y$=I /-Mq1V[ 74y(*9ޯ `GaP xA bѷͯ1ekTc I` a?I峬$CXs}fWޙI\5+6 wW~H=h]Un`*Pژ̘/}<mC&%#uJkCGpdє:dW.:Me1x7Xr=5G xHo;]fueD9-O.Cg -,V~1IS'6  PWĐlKÕA-#V8`/JufmxWRMNDe̊4>{-_m007ɣgerO){T'FFga?%W_.Itz+N "юzqX(6rKS\.}X@z&?OQz)V]~ܪT8V{c`$(utq&>d ]#k楖ׇX7YȊKz%h0fɍI)b?)ıuY?0n"*M+8X.p_%KXᛥaa-4ːL3^Bm`Ns3n4D[oE$`d]cd(LI]hImXs`)-oj"Kl74[`+w t/ñ^vgs;@oR{zkw!c[8x[%6^HwmK}!6mP4jr>շa!{ct& 8w?o׳=00!*EveiKthsZ1®!ۉ K\4Dr }_oS^UGg(+On%q_eyYrV{q>6x%clX3ѳ5=F1y2\լ9 4>CkՏs`{YVX&3'^\|W}Bt63[owFh!]̒,[(Vi*Sr~LG~Z+ᰀ([I(Cwy8P#i2z378ʮ?g'hrPۮ3iڼx]GXܘ-zV[vԊ+}*Ms/KԔ Ut^`շWXD[B\qIsaK (rཞoQ&TPHQV )Q8 +;3ŮYf")P,~V&[_:ݪana׿W3"O}yak8xÕ߸:wp#-!!BsbO8#.|ܸHGv YP VNSYƠ[0V6,^d=7PT1nDYqvAWi)3_Ӎ]d&G@ɬ%d 7~T#@ M sv2+E])8kH4|nX΅CEcJn*!\SQZEwjGlwH#%%Sg/oP-/Se΍Sj.\umjU@ X.YlīsarxyeӜ$Gue*MZxKmKǝ@ sG[HU0ztO:h&8hZyMa_hFKٷa?$UssWq{86V*瞙B+& ݴz*#f}TQ5_a/dB&B]>!xqF/}9 KfNK wu&xD'!5aJOjaNjϙK!fKfAW+Z_yޢe}Nr M ۰e5^;65Y&1j mx 4NMX3КuI>Ҟv<3b.V ~gk;/NO29nHX++RW[L[RD\ \Z8\\)WK![fl:9X % !RZTx[dFPKX\ ]]H))u)[]\[)*[ZzX[MY%#,\\)]XP-\[[*XX+sC/M[8[][#]XReW\[[mY NtX\h*)=\P[W]k[;[a[N)\ a\\O/[MXN]\m\3V[)[\"X)Q\[r[f\]Y[[)[L\\\i*G)+C+Z\)=V*]]]\k7[)X]!*[YMW;,$\MZ ZXX)W\[)[<]\Xu\]**]VWQWO[q[*5\\X\\aA3]D[})E]Z3["KYV[Z]J\X3Y[\[\O7  >7 F  Ev  41 4 z@q= H@ @ gE{  _M0  '@^ v D'0]$ 0= l  kk O0plM >% `%04 a  Du O @ XP@D D`t  Wh e 6 K@  "R&\x <0N R9<z Pc; >/M  `1T mL0  MP7 m )\ YP 189:  5i , D V i FX > *   85 C<  8Q   i% xA} k wK6pz -7  /`J t^k 8Ey  P8@" F06I    CL DT  :0{ `t . >V  ,24 9_ @M! k 2 (  -6   K@2 F  H  )\ '^, v @9 RF  U ; r2p^ Pu P. A0ke N) 2e k W 3p0@ %TT J  np4 > Q \ "0 = 1P@b  " q Gf  @( Z )M   eD  W` Epw  F k  > Z? Pj6p @ uRq 5 p:9 0: I0T  _ )Ro  3* > R 0N G0j B ]J/8? 50 j ,C7  "  QB HP  bV1 )U   }`> x9 p ~ N  X Ek) X0@P I5PS 7g  o n I[  0~ K ( @ , PDD  [47f 0rz T # p, e'`]$ C@@  8)k `qT РV C3 uX"!J B G P?n W@p2  A 0e% C5 n 2p @k7 88 rPb  K  ?  Y"N  ?Qi F .KA` " -T G7 ZT ( @ @> g L4 Jp  2rM0  [0`\a IVWZm% V` p Rx  R `e %? V \E@{ I CN  C:  o&Z^ nK0~ + FE`z  [ (3"4 &p{ C?  2K  40  &W L qSy  a _ B_ a }9`B'  n3) - w `W $* z J 6o Uh?  3>P  L0 I ]X@> I:H  +% , ? 5x.O eB O , &D@B O 6G S@ P O.JrDP  L|Qi  V  #Hp x ` Z\ dRq  O$/0l  $0 $; 8 RRq   * 3p,O  ( #f `f .E@y U @ , %- 9Qd  >S m @= o +eN  vVJu  2W N`  %4&YW # O 0zx ;Rpp  :Pi oA0x , p /6V BJa  X m [:P *d : V  @ = /E@ = "0 F@a  FO ; Ѕ4 G%Yp 66 2@ W H   { UL  6 ;p * K e Z,PE M0  =p h+ 5o  * T7h 9 I\ '  #`c 6 %QAE #\ `l% ( "0J Qh p S z ; ^0 i>  <M Q h  4OP: Pc < &p[$ x(  d"MP 1? : \ .< b mn > .83 I2r,6pr D@u  87g 18  ; < = "pr 4< 08 , T0 - 10 Ds ~ { 50g{ `> YA +; [ x BpB G4`7 8M  ]JDDC  %N : S}  #` '/ y g J  XVEv U pz o-`L69 #50< Y 5 Ry 9 ( \Gg ! sp-  M GT p 5j% WWB '\ Y 3 [d F d! ? eQe  g  g5p nF0  (h \N ? s WIJ r ` ( %@ ,  = pu U < r .  P<8 ws P .$l}0[_6  L5pk   , ! K 8"`L (0i  0DF ^K} + pw  U  .PO ` )k - C0? ~ :406-  8  |= )4`4 bR V7T D ~P E  !3,O o#@3 ,M qG@h  Sx ; =V Oi & l jC9 v g @  t/ p  /DB  ]h,`t C_  l&" 4L  ?  `r ':В Cp=  sU0 4 Dr C %P0b  2W  2i 6d V , > 63#L -#PL |O &Ex  Tp+ f >  I TI O X Z-0S //Z 43 dd .\ ZPb  5 5Gf  b  t6! #P; ) Dt I B` 4 r u SY`D ; * XU  L~PC, XC9  W0M Ql  @p= g A`y ; W`WB ZL@9 Z U C "J]  Rr N I;&4 ^04  @]  > h17 0aV d< h L N@ v + U Q  kk n -% pe P & )9p;  +7i ` 2/! O> hl 5 ` # ; @8{ +  S 0~r : Z@} 6 M , q1`k? XjZ Gpb  dp }5A  eHA4 0  @ | $ ^ j * ]  } t 7U  S@ 6Sx v sp 0@I 0@; i ZW& M @ tC : = H v 2! y@  q7 w+ z C`: I D,P  p M!P ? _O%']$ E = &4 )Hq p -D Y@   5O~Y0J Hx(^[ Fl  Ec  `^8`$W $d=i {J90-_ A`x  - |V 4 rO j 2Zk2 Np ` VE-p| @jk \9.p $hDr C O#= ' 20" R r s Hp } Rx ~ 9DPC  " Gi  ,p4 H0 ( 1 8` w + V 6> /@ BPb  B@02 ; ! 6x< PH  O O ? 6u  ? I /`T=@V 1*k  p4 P6 ? %  P L  +@< DA  C;  N Sp~ ; 9a ab6 90|M O *pb B #Tn% 8Fj V 7 #P4 <0 b ]2qG[  C@ I -2` d) 04 :!@'1Ќ T`  Q4p7+ _`!n }N   ,@Z Jpq " uTR [% "(P_, J , !   ;~ g9Y _ T?` B VSPy 4 NB S V 6 B=  B9`<o a Y C> ~ W(0y X S{ 3 "  : E u%_hx-@E %C<  Q FpF  T  =09 B<  #X90:g < h  %OI o  c @pj 9 &Mr:0j = i F   T|A 5|NYA  r 180P0 41X=$ 99o }@ A l Gi - 1@_ 7PE r Gm 4 -mo k-\ k\ WVB '.  ,F (  k  ?p B Pb A <$p6 S&0Z^ ` + fJo  ~4 GZ`la jZ}( 4 4 !нq Kp  J/0J h 5e4 2@ KЯ ( <P F  0]]  XZpmc 3@! Gn l Z@+ ' ^ )Z[k X% T1 }; _ u. 9"  4`L z" {B`  v!- I0P  <e $SJh  < Ds I tE |  8C`8 H 2K 2?@  QEz I  Wx)@ F}  (l _ @ ()Pj >1 j@< B0c J 4ORo  f`e  46`v .`O 7p>t pW  ;@ y N `O ?#  >0 N c o n F` ~ o (@l4 \P (! ? bV t@ H@ - miq A(_D >Hpq 0 l  D A  AW 5 Op! l / T GA@k  6=< > ^ ] K ? ,A O M$ 5 ~ШP P`N { =W s T3)T  U < ?7`\  BK b E v  /`= I< b pJ QHPx  Y  H`p h <  0@83 _.@O Gn   }P %1+ P.d >  4 l @i i 2JP_  E = 3 .C p X UW: ZDPE  1Z0l% 4 pK KY B [ `x:P W < Iv Q   > % oB`  :0  Rr  &[$ B  DQ 4 WXi 2 p Lt8 3n 0    u$J & C0` 7PA 7' n]  $^`8 H U R j0 y 2 ij )` V7Z s  n FZl% uZ`D 7PS ' `j 8I f P[ % @Z   'I  0 > 9p~  C: 7 ;0 ; FC8 U t/  B6` ! ? n(  =2 I  T : 9" C# = V  vIPM    #D @ '`^_ 5B0    p00; N 4 > 9 p_  !H <0 h j(b - [p^D 1% T B 3-4 > .E P D HI0I  !6z 0  n0m pH  *pi  C0> ~ )8W  o3% ( mN C ` I S0E GGpg  q @` a E j _ 6@! 0V p480 F@ ) =80c 8 $Ѕ .O ! @YBd % jk oJ 9 8@0 }=@F D`r C 1pj 4 e1Y "0 k|2+ ~- J\ ' 5j_ ,w^ MQd  L@  V5o : S P B 4 S Q  <% t n 6 8kG e$|}4f Z :W (@k M>p N p2 @] @0_ g  iP Y  Pb  2 dl :@Wd M Pj b=@ D v U tW: IPR  ,, "+ -`BH? W  ve + W/`5r `RW =&` E } Fp  Ds  &[$ CUМ 4 ~K` ? n?  Hp (   Gf  9{ 1`K$x1ж * J C T  P 1/ lS K+ c G E@ Z 0S+N  (@i  ^#5z 30  P  J<1 <4 j70 @ | 01 I= V$ Pu &Ex  U` ; 1p  Q0d E R  ,   j H o*F cb y  W@ $~z OPq  HTp  j   +2 % Wi P #-0G L j c;0c I  M`z e Up ; 5 l  J  2V* __gmon_start___fini__cxa_finalize_Jv_RegisterClasses_Py_svnversionPy_GetBuildInfoPy_SubversionRevisionPy_SubversionShortBranchPyOS_snprintfPyGrammar_RemoveAcceleratorsPyObject_FreePyGrammar_AddAcceleratorsPyObject_Malloc__printf_chkPyGrammar_FindDFAstderr__fprintf_chkPyGrammar_LabelRepr_PyParser_TokenNamesPyNode_ListTreestdoutPyNode_FreePyNode_AddChildPyObject_ReallocPyNode_NewPyParser_AddTokenstrcmpPyParser_DeletefreePyParser_NewmallocPyTokenizer_GetstrncpyPyTokenizer_RestoreEncodingPyTokenizer_FreePyParser_ParseFileFlagsExPyTokenizer_FromFilePy_TabcheckFlagPy_VerboseFlagPyParser_ParseFileFlagsPyParser_ParseFilePyParser_ParseStringFlagsFilenameExPyTokenizer_FromStringPyErr_OccurredPyParser_ParseStringFlagsFilenamePyParser_ParseStringFlagsPyParser_ParseString_Py_addbit_Py_samebitset_Py_mergebitset_Py_delbitset_Py_newbitsetPy_FatalError_Py_meta_grammarPy_DebugFlag_Py_findlabel_Py_addfirstsets_Py_translatelabels__ctype_b_locstrchrstrlenPyToken_ThreeCharsPyToken_TwoCharsPyToken_OneChar_Py_addarc_Py_addstate_Py_addlabel__strdup_Py_adddfa_Py_newgrammar_Py_pgenPyOS_InputHook__errno_locationfgetsfeofPyOS_InterruptOccurred_PyOS_ReadlineTStatePyEval_RestoreThreadPyErr_CheckSignalsPyEval_SaveThreadPyOS_StdioReadlinefflushPyExc_OverflowErrorPyErr_SetStringPyOS_Readline_PyThreadState_CurrentPyOS_ReadlineFunctionPointerPyThread_acquire_lockfilenoisattyPyThread_release_lockPyThread_allocate_lockPyExc_RuntimeErrorPyUnicodeUCS4_DecodeUTF8PyUnicodeUCS4_AsEncodedStringPyErr_ClearPyString_SizePyString_AsStringPySys_WriteStderrmemcpyPyUnicodeUCS4_DecodePyUnicodeUCS4_AsUTF8String__ctype_tolower_locstrncmpPyExc_SyntaxErrorPyErr_FormatPyString_TypePyString_FromStringAndSizePy_UniversalNewlineFgets__sprintf_chkPyObject_CallObjectPyFile_FromFilePyCodec_StreamReaderPyObject_GetAttrStringungetc_IO_getcstdinPySys_GetFilestrcpyPyObject_Size__rawmemchrPySys_GetObjectPyFile_TypePyType_IsSubtypePyExc_UnicodeDecodeErrorPyErr_ExceptionMatchesstrstrPy_Py3kWarningFlagPyExc_DeprecationWarningPyErr_WarnExplicitPyObject_CheckReadBufferPyBuffer_IsContiguousPyBuffer_GetPointerPyBuffer_FillContiguousStridesPyBuffer_ReleasePyNumber_CheckPyIter_NextPyExc_StopIterationPyObject_GetBufferPyExc_TypeErrorPyExc_SystemErrorPyMapping_SizePyMapping_LengthPySequence_DelSlicePySequence_DelItemPySequence_SetItemPySequence_GetItemPySequence_SizePySequence_LengthPyNumber_IndexPyNumber_AbsolutePyNumber_InvertPyNumber_PositivePyNumber_NegativePyObject_LengthPyObject_TypePyBuffer_FillInfoPyExc_BufferErrorPyObject_AsWriteBufferPyObject_AsReadBufferPyObject_AsCharBufferPyObject_GetAttrPyString_InternFromStringPyExc_AttributeErrorPyClass_TypePyClass_IsSubclass_PyObject_RealIsSubclassPyInstance_Type_PyObject_RealIsInstancePyObject_Call_Py_CheckRecursionLimit_Py_CheckRecursiveCallPyTuple_NewPyObject_CallFunctionObjArgsPyObject_IsSubclassPyErr_FetchPyErr_RestorePyObject_IsTruePyObject_IsInstancePyObject_CallMethodObjArgs_PyObject_CallMethod_SizeTPyCallable_Check_Py_VaBuildValue_SizeT_PyObject_CallFunction_SizeTPyObject_CallMethodPy_VaBuildValuePyObject_CallFunctionPyEval_CallObjectWithKeywords_PyNumber_ConvertIntegralToIntPyMapping_CheckPyObject_HasAttrStringPySequence_CheckPyDict_TypePyObject_GetIterPySeqIter_New_PySequence_IterSearchPyObject_RichCompareBoolPyExc_ValueErrorPySequence_IndexPySequence_ContainsPySequence_InPySequence_CountPySequence_ListPyList_New_PyList_ExtendPySequence_FastPyList_TypePyTuple_TypePySequence_SetSlice_PySlice_FromIndicesPySequence_GetSlice_Py_NotImplementedStructPyNumber_CoerceExPySequence_InPlaceRepeatPyInt_FromSsize_tPySequence_InPlaceConcatPyNumber_InPlaceRemainderPyNumber_InPlaceTrueDividePyNumber_InPlaceFloorDividePyNumber_InPlaceDividePyNumber_InPlaceSubtractPyNumber_InPlaceRshiftPyNumber_InPlaceLshiftPyNumber_InPlaceAndPyNumber_InPlaceXorPyNumber_InPlaceOrPyNumber_InPlaceAddPySequence_RepeatPySequence_ConcatPyNumber_RemainderPyNumber_TrueDividePyNumber_FloorDividePyNumber_DivmodPyNumber_DividePyNumber_SubtractPyNumber_RshiftPyNumber_LshiftPyNumber_AndPyNumber_XorPyNumber_OrPyNumber_AddPyNumber_ToBase_PyInt_Format_PyLong_FormatPyNumber_FloatPyFloat_TypePyFloat_FromDoublePyFloat_FromStringPyLong_FromStringPyNumber_LongPyLong_FromLong_PyLong_CopyPyLong_FromUnicodePyInt_FromStringPyNumber_IntPyInt_TypePyInt_FromLongPyInt_FromUnicodePyNumber_AsSsize_tPyInt_AsSsize_tPyErr_GivenExceptionMatches_PyLong_SignPyNumber_InPlaceMultiplyPyNumber_MultiplyPyObject_DelItemPyExc_IndexErrorPyObject_DelItemStringPyString_FromStringPyObject_SetItemPyMapping_SetItemStringPyObject_GetItemPyMapping_HasKeyPyMapping_GetItemStringPyMapping_HasKeyString_Py_NoneStructPyNumber_CoercePyNumber_InPlacePowerPyNumber_PowerPyObject_Format_PyType_LookupPyObject_UnicodePyType_ReadyPyObject_CopyDataPyMem_MallocPyMem_FreePyErr_NoMemoryPyBuffer_FromContiguousPyBuffer_ToContiguous_PyObject_LengthHintPyLong_AsSsize_tPySequence_TuplePyList_AsTuple_PyTuple_ResizePyObject_CmpPyObject_ComparePyBool_FromLong_Py_ZeroStruct_Py_TrueStructPyBool_TypePyArg_ParseTupleAndKeywordsfputsPyType_Type_Py_HashSecretPyErr_BadArgumentPySlice_TypePySlice_GetIndicesExPyExc_MemoryErrorPyString_FromFormatPyBuffer_NewPyBuffer_TypePyObject_InitPyBuffer_FromReadWriteMemoryPyBuffer_FromMemoryPyBuffer_FromReadWriteObjectPyBuffer_FromObjectPyErr_WarnEx_PyArg_NoKeywordsPyArg_ParseTuplePyObject_GenericGetAttr_Py_bytes_isspace_Py_ctype_table_Py_bytes_isalpha_Py_bytes_isalnum_Py_bytes_isdigit_Py_bytes_title_Py_ctype_toupper_Py_ctype_tolower_Py_bytes_capitalize_Py_bytes_swapcase_Py_bytes_upper_Py_bytes_lower_Py_bytes_istitle_Py_bytes_isupper_Py_bytes_islower_Py_isspace__doc___Py_isalpha__doc___Py_isalnum__doc___Py_isdigit__doc___Py_islower__doc___Py_isupper__doc___Py_istitle__doc___Py_lower__doc___Py_upper__doc___Py_title__doc___Py_capitalize__doc___Py_swapcase__doc__PyByteArray_FiniPyByteArray_SizePyByteArray_AsString_PyByteArray_empty_string_PyEval_SliceIndex_PyArg_ParseTuple_SizeTPyLong_AsLongPyCodec_DecodePyUnicodeUCS4_GetDefaultEncodingPyUnicodeUCS4_DecodeLatin1_Py_BuildValue_SizeTPyUnicodeUCS4_FromStringPyByteArray_TypePyByteArrayIter_Type_PyObject_GC_New_PyGC_generation0_PyErr_BadInternalCallPyUnicode_TypePy_BytesWarningFlagPyExc_BytesWarningPyUnicodeUCS4_FromUnicodePyUnicodeUCS4_ResizePyErr_PrintPyByteArray_ResizePyMem_Reallocmemmovememset_PyArg_ParseTupleAndKeywords_SizeTPyCodec_EncodePyByteArray_FromStringAndSize_PyObject_NewPyArg_UnpackTuplePyList_AppendmemcmpPyList_ReversePyByteArray_ConcatPyByteArray_InitPyByteArray_FromObjectPyType_GenericAllocPyType_GenericNewPyObject_SelfIterPyCell_SetPyCell_TypePyCell_GetPyCell_NewPyTuple_PackPyTuple_SizePyTuple_GetItemPyInt_AsLongPyObject_HashPyObject_ReprPyObject_ClearWeakRefsPyMethod_ClearFreeListPyMethod_FiniPyDict_GetItem_Py_SwappedOp_PyInstance_LookupPyEval_GetRestrictedPy_BuildValuePyObject_HasAttrPyDict_SetItemPyDict_DelItem_Py_HashPointerPyDict_GetItemString_PyWeakref_ClearRefPyErr_WriteUnraisablePyMethod_ClassPyMethod_TypePyMethod_SelfPyMethod_FunctionPyMethod_NewPyInstance_NewRawPyDict_NewPyInstance_NewPyDict_SizePyClass_NewPyEval_GetGlobalsPyEval_GetFuncDescPyEval_GetFuncNamePyObject_GenericSetAttrPyCObject_SetVoidPtrPyCObject_TypePyCObject_GetDescPyCObject_AsVoidPtrPyCObject_ImportPyImport_ImportModulePyCObject_FromVoidPtrAndDescPyCObject_FromVoidPtrPyCode_CheckLineNumberPyCode_TypePyCode_Addr2LinePyString_InternInPlacePyCode_New_Py_c_sum_Py_c_diff_Py_c_neg_Py_c_prod_Py_c_quotPyComplex_ImagAsDoublePyComplex_TypePyFloat_AsDoublePyLong_AsDoublePyComplex_RealAsDoublePyUnicodeUCS4_EncodeDecimalPyOS_ascii_strtod_Py_HashDoublePyComplex_AsCComplexPyComplex_FromCComplexPyExc_ZeroDivisionErrorPy_DivisionWarningFlagPyComplex_FromDoubles_Py_c_abs__isinfhypot_Py_c_powatan2sincoslog__isnanPyOS_ascii_formatdPyProperty_TypePyObject_SetAttrStringPyObject_RichComparePyMember_SetOnePyMember_GetOnePyWrapper_NewPyTuple_GetSlicePyDictProxy_NewPyDictProxy_Type_PyTrash_delete_nesting_PyTrash_delete_later_PyTrash_deposit_object_PyTrash_destroy_chainPyDescr_NewWrapperPyWrapperDescr_TypePyDescr_NewGetSetPyGetSetDescr_TypePyDescr_NewMemberPyMemberDescr_TypePyDescr_NewClassMethodPyDescr_NewMethodPyCFunction_NewExPyReversed_TypePyEnum_TypePyUnicodeEncodeError_SetStartPyUnicodeDecodeError_SetStartPyUnicodeTranslateError_SetStartPyUnicodeEncodeError_SetEndPyUnicodeDecodeError_SetEndPyUnicodeTranslateError_SetEnd_PyExc_FiniPyExc_MemoryErrorInstPyDict_SetItemStringPyDict_DelItemStringPyObject_SetAttrPyUnicodeTranslateError_SetReasonPyUnicodeDecodeError_SetReasonPyUnicodeEncodeError_SetReasonPyString_FormatstrrchrPyString_ConcatAndDel_PyExc_InitPy_InitModule4PyModule_GetDictPyExc_BaseExceptionPyModule_AddObjectPyExc_ExceptionPyExc_StandardErrorPyExc_GeneratorExitPyExc_SystemExitPyExc_KeyboardInterruptPyExc_ImportErrorPyExc_EnvironmentErrorPyExc_IOErrorPyExc_OSErrorPyExc_EOFErrorPyExc_NotImplementedErrorPyExc_NameErrorPyExc_UnboundLocalErrorPyExc_IndentationErrorPyExc_TabErrorPyExc_LookupErrorPyExc_KeyErrorPyExc_UnicodeErrorPyExc_UnicodeEncodeErrorPyExc_UnicodeTranslateErrorPyExc_AssertionErrorPyExc_ArithmeticErrorPyExc_FloatingPointErrorPyExc_ReferenceErrorPyExc_WarningPyExc_UserWarningPyExc_PendingDeprecationWarningPyExc_SyntaxWarningPyExc_RuntimeWarningPyExc_FutureWarningPyExc_ImportWarningPyExc_UnicodeWarningPyExc_RecursionErrorInstPyUnicodeTranslateError_CreatePyUnicodeDecodeError_CreatePyUnicodeEncodeError_CreatePyUnicodeTranslateError_GetReasonPyUnicodeDecodeError_GetReasonPyUnicodeEncodeError_GetReasonPyUnicodeDecodeError_GetEndPyUnicodeDecodeError_GetStartPyUnicodeDecodeError_GetObjectPyUnicodeDecodeError_GetEncodingPyUnicodeEncodeError_GetEncodingPyUnicodeEncodeError_GetObjectPyUnicodeTranslateError_GetObjectPyUnicodeEncodeError_GetStartPyUnicodeTranslateError_GetStartPyUnicodeEncodeError_GetEndPyUnicodeTranslateError_GetEndPyGen_NeedsFinalizingPyEval_EvalFrameExPyErr_SetNonePyTraceBack_TypePyErr_NormalizeExceptionPyGen_NewPyGen_TypePyFile_IncUseCountPyFile_DecUseCountPyFile_SetEncodingAndErrorsPyFile_SetEncodingPyErr_SetFromErrnoclearerrPyList_GetSlicePyList_SetItemfwriteflockfilefunlockfile_PyString_Resize__uflowferrorftello64PyLong_FromLongLongPyLong_AsLongLongftruncate64fseeko64PyFile_NamePyFile_AsFile__fxstat64lseek64ftellstrerrorPyErr_SetObject_PyFile_SanitizeModefopen64PyErr_SetFromErrnoWithFilenameObjectPyFile_FromStringfclosePyUnicodeUCS4_AsUnicodeEscapeStringPy_UniversalNewlineFreadfreadPyString_ConcatPyObject_AsFileDescriptorPyFile_WriteObjectPyObject_PrintPyFile_WriteStringPyFile_SoftSpacePyFile_GetLinePyFile_SetBufSizesetvbufPy_FileSystemDefaultEncodingPyFloat_GetMaxPyFloat_GetMin_PyFloat_FormatAdvanced_PyFloat_Pack8frexpldexpPyString_AsStringAndSizePyLong_TypePyLong_FromDoublefmod_PyLong_NumBitsmodf_PyFloat_Unpack8_PyFloat_Unpack4_PyFloat_Pack4__isinffPyFloat_ClearFreeList_PyFloat_InitPyStructSequence_InitTypePyOS_mystrnicmpPyOS_ascii_atofPyFloat_GetInfoPyStructSequence_NewPyFloat_AsStringExPyFloat_AsStringPyFloat_FiniPyFloat_AsReprStringPyFrame_ClearFreeListPyFrame_FiniPyFrame_LocalsToFastPyFrame_FastToLocalsPyFrame_BlockPopPyFrame_BlockSetupPyFrame_NewPyModule_Type_PyObject_GC_ResizePyFrame_Type_PyObject_GC_NewVar_PyFrame_InitPyStaticMethod_NewPyStaticMethod_TypePyClassMethod_NewPyClassMethod_TypePyEval_EvalCodeExPyFunction_SetClosurePyFunction_TypePyFunction_GetClosurePyFunction_SetDefaultsPyFunction_GetDefaultsPyFunction_GetModulePyFunction_GetGlobalsPyFunction_GetCodePyFunction_NewPyInt_GetMax_PyInt_FormatAdvancedPyInt_ClearFreeListPyInt_Fini_PyInt_InitPyOS_strtolPyOS_strtoulPyInt_AsUnsignedLongLongMaskPyLong_AsUnsignedLongLongMaskPyInt_AsUnsignedLongMaskPyLong_AsUnsignedLongMaskPyInt_FromSize_tPyLong_FromSize_tPyCallIter_NewPyCallIter_TypePySeqIter_TypePyList_FiniPyLong_FromSsize_tPyList_SortPyList_InsertPyList_SizePyListRevIter_TypePyList_GetItemPyListIter_TypePy_ReprEnterPy_ReprLeavePyList_SetSlice_PyString_JoinPyObject_HashNotImplemented_PyLong_FormatAdvanced_PyLong_AsByteArrayPyLong_AsUnsignedLongLong_PyLong_AsScaledDoublePyLong_AsUnsignedLongPyLong_AsVoidPtr_PyLong_NewPyObject_InitVar_Py_Ticker_Py_CheckInterval_PyLong_DigitValuePyLong_FromUnsignedLongLongPyLong_FromUnsignedLongPyLong_FromVoidPtrPyTuple_SetItem_PyLong_FromByteArray_PyDict_Next_PyDict_ContainsPyDict_FiniPyDictIterItem_TypePyDictIterValue_TypePyDictIterKey_Type_PyString_EqPyDict_ItemsPyDict_ValuesPyDict_Keys_PyDict_NewPresizedPyDict_MergeFromSeq2PySet_TypePyFrozenSet_Type_PySet_NextEntryPyDict_MergePyDict_CopyPyDict_UpdatePyDict_ClearPyCFunction_TypePyCFunction_ClearFreeListPyCFunction_FiniPyCFunction_CallPyCFunction_GetFlagsPyCFunction_GetSelfPyCFunction_GetFunctionPyCFunction_NewPy_FindMethodInChainPy_FindMethod_PyModule_ClearPyModule_GetFilenamePyModule_GetNamePyModule_NewPy_IncRefPy_DecRef_PyObject_GetDictPtrPyObject_NotPyThreadState_GetDict_Py_ReadyTypes_PyWeakref_RefType_PyWeakref_CallableProxyType_PyWeakref_ProxyTypePySuper_TypePyBaseObject_TypePyRange_TypePyEllipsis_Type_PyUnicodeUCS4_AsDefaultEncodedStringPyObject_DirPyEval_GetLocals_PyObject_SlotComparePyUnicodeUCS4_FromEncodedObject_PyObject_Str_PyObject_DumpPyGILState_EnsurePyGILState_Release_PyObject_Del_PyObject_NewVar_Py_cobject_hack_Py_abstract_hackPySet_FiniPySet_Pop_PySet_NextPySet_DiscardPySet_ContainsPySet_SizePySet_AddPyFrozenSet_NewPySet_New_PySet_UpdatePySet_ClearPySlice_GetIndicesPySlice_New_Py_EllipsisObjectPyString_Fini_PyBytes_FormatAdvancedPyUnicodeUCS4_TailmatchPyUnicodeUCS4_FindPyUnicodeUCS4_CountPyUnicodeUCS4_ContainsPyUnicodeUCS4_Concatfputc_Py_ReleaseInternedStringsPyString_InternImmortalPyUnicodeUCS4_FromObject_PyUnicode_XStripPyUnicodeUCS4_RPartitionPyUnicodeUCS4_Partition__ctype_toupper_locPyUnicodeUCS4_RSplitPyUnicodeUCS4_SplitPyUnicodeUCS4_JoinPyString_Repr_PyString_InsertThousandsGroupinglocaleconvPyUnicodeUCS4_Translate_PyString_FormatLongPyString_DecodeEscapePyString_AsEncodedObjectPyString_AsEncodedStringPyString_EncodePyString_AsDecodedObjectPyString_AsDecodedStringPyString_DecodePyString_FromFormatVPyUnicodeUCS4_ReplacePyBaseString_Type_PyArg_Parse_SizeTPyUnicodeUCS4_Format__strncpy_chkPyStructSequence_UnnamedFieldPyTuple_ClearFreeListPyTuple_FiniPyTupleIter_TypePyType_ModifiedPyType_ClearCachePyImport_ImportPyEval_CallMethodPyWeakref_NewRefqsortPyEval_GetBuiltins_Py_Mangle_PyObject_GC_Malloc_PyWeakref_GetWeakrefCountPyWeakref_GetObjectPyWeakref_NewProxyPyUnicodeUCS4_GetMaxPyUnicodeUCS4_ClearFreelist_PyUnicodeUCS4_Fini_PyUnicodeUCS4_ToDecimalDigit_PyUnicode_FormatAdvancedPyUnicodeUCS4_FromOrdinal_PyUnicodeUCS4_IsAlpha_PyUnicodeUCS4_IsDecimalDigit_PyUnicodeUCS4_IsDigit_PyUnicodeUCS4_IsNumeric_Py_ascii_whitespace_PyUnicodeUCS4_IsWhitespace_PyUnicodeUCS4_IsUppercase_PyUnicodeUCS4_IsTitlecase_PyUnicodeUCS4_IsLowercase_PyUnicodeUCS4_ToUppercase_PyUnicodeUCS4_ToLowercase_PyUnicodeUCS4_ToTitlecasePyUnicodeUCS4_EncodeUTF16PyUnicodeUCS4_EncodeUTF32PyUnicodeUCS4_EncodeUnicodeEscapePyUnicodeUCS4_EncodeRawUnicodeEscapePyUnicodeUCS4_EncodeUTF8PyUnicodeUCS4_AsWideCharPyUnicodeUCS4_FromWideCharPyUnicodeUCS4_AsRawUnicodeEscapeStringPyUnicodeUCS4_AsUTF16StringPyUnicodeUCS4_AsUTF32StringPyUnicodeUCS4_GetSizePyUnicodeUCS4_AsUnicodePyCodec_LookupErrorPyCodec_StrictErrorsPyUnicodeUCS4_EncodeASCIIPyUnicodeUCS4_AsASCIIStringPyUnicodeUCS4_EncodeLatin1PyUnicodeUCS4_EncodeCharmapPyUnicodeUCS4_AsCharmapStringPyUnicodeUCS4_AsLatin1StringPyUnicodeUCS4_DecodeCharmapPyUnicodeUCS4_DecodeASCII_PyUnicode_DecodeUnicodeInternalPyUnicodeUCS4_DecodeUTF16StatefulPyUnicodeUCS4_DecodeUTF16PyUnicodeUCS4_DecodeUTF32StatefulPyUnicodeUCS4_DecodeUTF32PyUnicodeUCS4_DecodeUTF8StatefulPyUnicodeUCS4_FromStringAndSizePyUnicodeUCS4_DecodeRawUnicodeEscapePyUnicode_EncodeUTF7PyUnicode_DecodeUTF7StatefulPyUnicode_DecodeUTF7PyUnicodeUCS4_DecodeUnicodeEscapePyImport_ImportModuleNoBlockPyUnicodeUCS4_EncodePyUnicodeUCS4_AsEncodedObjectPyUnicode_AsDecodedObjectPyUnicodeUCS4_ComparePyUnicodeUCS4_RichComparePyUnicodeUCS4_Splitlines_PyUnicodeUCS4_IsLinebreakPyUnicodeUCS4_FromFormatV__memmove_chkPyUnicodeUCS4_FromFormat_PyUnicodeUCS4_InitPyUnicode_BuildEncodingMapPyUnicodeUCS4_SetDefaultEncoding_PyCodec_LookupPyUnicodeUCS4_TranslateCharmap_PyUnicode_TypeRecords_PyUnicodeUCS4_ToDigit_PyUnicodeUCS4_ToNumericPyImport_GetModuleDict_Py_DisplaySourceLine_PyWarnings_InitPyThreadState_GetPyErr_WarnPyAST_CheckPyArena_AddPyObjectPyAST_mod2objinit_astPyModule_AddIntConstantPyModule_AddStringConstant_Py_aliasPyArena_Malloc_Py_keyword_Py_arguments_Py_ExceptHandler_Py_comprehension_Py_Index_Py_ExtSlice_Py_Slice_Py_Ellipsis_Py_Tuple_Py_List_Py_Name_Py_Subscript_Py_Attribute_Py_Str_Py_Num_Py_Repr_Py_Call_Py_Compare_Py_Yield_Py_GeneratorExp_Py_ListComp_Py_Dict_Py_IfExp_Py_Lambda_Py_UnaryOp_Py_BinOp_Py_BoolOpasdl_seq_newasdl_int_seq_new_Py_Continue_Py_Break_Py_Pass_Py_Expr_Py_Global_Py_Exec_Py_ImportFrom_Py_Import_Py_Assert_Py_TryFinally_Py_TryExcept_Py_Raise_Py_With_Py_If_Py_While_Py_For_Py_Print_Py_AugAssign_Py_Assign_Py_Delete_Py_Return_Py_ClassDef_Py_FunctionDef_Py_Suite_Py_Expression_Py_Interactive_Py_ModulePyAST_obj2modPy_UnicodeFlagPyAST_FromNodePyErr_ProgramText_PyBuiltin_InitPy_OptimizeFlagPyImport_ReloadModulePyArg_ParsePyEval_MergeCompilerFlagsPyRun_StringFlags__xstat64PyRun_FileExFlagsPyErr_SetFromErrnoWithFilenamePyEval_EvalCodePyArena_NewPyAST_CompilePyArena_FreePy_CompileStringFlagsPyImport_ImportModuleLevelPyEval_GetCallStatsPyEval_ThreadsInitializedPy_AddPendingCallPy_GetRecursionLimitPy_SetRecursionLimitPyEval_SetProfilePyEval_SetTracePyEval_GetFrame_PyThreadState_GetFramePyEval_CallObject_PyEval_CallTracingPy_FlushLinePyThreadState_SwapPyEval_ReleaseThreadPyEval_ReleaseLockPyEval_AcquireThreadPyEval_AcquireLockPy_MakePendingCallsPyThread_get_thread_identPySys_SetObjectPyTraceBack_Here_Py_QnewFlagPyEval_EvalFramePyEval_InitThreadsPyEval_ReInitThreadsPySymtable_LookupPyST_GetScopePyCode_OptimizePyFuture_FromASTPySymtable_BuildPySymtable_FreePyNode_CompilePyCodec_BackslashReplaceErrorsPyCodec_XMLCharRefReplaceErrorsPyCodec_ReplaceErrorsPyCodec_IgnoreErrorsPyCodec_RegisterErrorPyCodec_StreamWriterPyCodec_IncrementalDecoderPyCodec_IncrementalEncoderPyCodec_DecoderPyCodec_EncoderPyCodec_RegisterPyErr_NewExceptionPyErr_SyntaxLocationPyImport_FrozenModulesPy_FrozenMainPy_IgnoreEnvironmentFlagPy_FrozenFlagPy_SetProgramNamePy_InitializePySys_SetArgvPyImport_ImportFrozenModulePy_FinalizePyRun_AnyFileExFlagsPy_GetCopyrightPy_GetVersiongetenvsetbuf_PyArg_ParseGid_PyArg_ParseUid_PyObject_FromGid_PyObject_FromUid_PyArg_VaParseTupleAndKeywords_SizeTPyArg_VaParseTupleAndKeywords_PyArg_VaParse_SizeTPyArg_VaParsePy_GetCompilerPyOS_GetLastModificationTimePy_GetPlatform_PyParser_GrammarPyImport_GetMagicNumber_PyImport_IsScriptPyImport_ExtendInittabPyMarshal_ReadLastObjectFromFilePyNullImporter_TypePyImport_GetImporter__strcpy_chk_PyImport_Filetabstrcat_PyImport_FindModule_PyImport_LoadDynamicModuleinitimpPyMarshal_ReadObjectFromStringPyImport_AddModulePyImport_ExecCodeModuleExPyParser_ASTFromFileunlinkfdopenPyMarshal_WriteLongToFilePyMarshal_WriteObjectToFile__memcpy_chkPyMarshal_ReadLongFromFilefseekPyImport_ExecCodeModule_PyImport_FindExtension_PyImport_FixupExtensionPyImport_Cleanup_PyImport_ReInitLock_PyImport_ReleaseLock_PyImport_AcquireLock_Py_rhythmbox_workaround_rhbz684991_PyImport_Fini_PyImportHooks_Init_PyImport_Init_PyImport_DynLoadFiletabPyImport_AppendInittab_PyImport_Inittab_PyImport_GetDynLoadFunc_Py_PackageContextPyMarshal_InitPyMarshal_ReadShortFromFilePyMarshal_ReadObjectFromFile_IO_putcPyMarshal_WriteObjectToStringPy_IsInitializedPyEval_CallFunctionPyOS_vsnprintf__vsnprintf_chkPyFPE_dummy_Py_force_doublePyInterpreterState_HeadPyInterpreterState_NextPyInterpreterState_ThreadHeadPyThreadState_NextPyGILState_GetThisThreadStatePyThread_get_key_value_PyGILState_FiniPyThread_delete_keyPyThread_set_key_value_PyGILState_InitPyThread_create_key_PyThreadState_Init_PyThread_CurrentFramesPyThreadState_SetAsyncExcPyThreadState_DeleteCurrentPyThread_delete_key_valuePyThreadState_DeletePyInterpreterState_DeletePyThreadState_ClearPyInterpreterState_Clear_PyThreadState_PreallocPyThreadState_NewPyInterpreterState_NewPy_GetProgramNamePy_SetPythonHomePy_AtExitPyOS_setsigsigemptysetsigactionPyOS_getsigPy_FdIsInteractivePy_InteractiveFlagabortPyParser_SetErrorPyParser_SimpleParseStringFlagsFilenamePyParser_SimpleParseStringFilenamePyParser_SimpleParseStringFlagsPyParser_SimpleParseStringPyParser_SimpleParseFileFlagsPyParser_SimpleParseFilePyParser_ASTFromStringPy_SymtableStringPy_CompileStringPyRun_FileFlagsPyRun_FileExPyRun_FilePyRun_StringPyErr_DisplayPyTraceBack_PrintPy_GetPythonHomePy_EndInterpreterPyModule_GetWarningsModulePyOS_FiniInterruptsPyGC_CollectPy_ExitPy_InspectFlagPyErr_PrintExPyRun_SimpleStringFlagsPyRun_SimpleStringPyRun_SimpleFileExFlagsrewindPyRun_SimpleFileExPyRun_SimpleFilePyRun_InteractiveOneFlagsPyRun_InteractiveOnePyRun_InteractiveLoopFlagsPyRun_InteractiveLoopPyRun_AnyFileFlagsPyRun_AnyFileExPyRun_AnyFilePy_NewInterpreterPy_GetPathPySys_SetPathPy_NoSiteFlagPy_InitializeEx_PyRandom_Init_PySys_InitPySys_HasWarnOptionssetlocalenl_langinfoPy_HashRandomizationFlagPyOS_InitInterruptsPy_DontWriteBytecodeFlagPy_UseClassExceptionsFlagPy_NoUserSiteDirectory_PyOS_URandom_Py_HashSecret_InitializedPyMember_SetPyMember_GetPySTEntry_TypePySys_AddWarnOptionPySys_ResetWarnOptionsPySys_SetArgvExreadlink__realpath_chk__vfprintf_chkPySys_WriteStdoutPy_GetProgramFullPathPy_GetPrefixPy_GetExecPrefix_PyOS_ResetGetOpt_PyOS_opterr_PyOS_optind_PyOS_optarg_PyOS_GetOptPyOS_mystricmp__strcat_chkdlsymdlopendlerrorPyThread_init_threadPyThread_get_stacksizePyThread_set_stacksizepthread_attr_initpthread_attr_setstacksizepthread_attr_destroysem_postperrorsem_waitsem_trywaitPyThread_free_locksem_destroysem_init_exitPyThread__exit_threadPyThread_exit_threadpthread_selfPyThread_ReInitTLSPyThread_start_new_threadpthread_attr_setscopepthread_createpthread_detachinitthreadinitsignalinitposixiniterrnoinitpwdinit_sreinit_codecsinitzipimportinit_symtableinitgcgetcwdstrncatPy_GetArgcArgvPy_Main_PyObject_GC_UnTrack_PyObject_GC_Del_PyObject_GC_Track_PyGC_DumpPyErr_SetInterruptPySignal_SetWakeupFdPyOS_AfterForkgetpid__libc_current_sigrtmin__libc_current_sigrtmaxpausesiginterruptgetitimerfloorsetitimeralarmgetloadavgsysconffpathconfconfstrtmpnam_rtempnamtmpfile64fstatvfs64fdatasyncfsyncfchdirunsetenvputenv__xmknodmkfifopipefcntldup2rmdirchrootsymlinkrenametcsetpgrptcgetpgrpsetpgidsetsidgetsidwaitpidwait4wait3getpgidsetgroupssetgidsetregidsetreuidsetegidseteuidsetuidpopenpclosekillpgkillgetlogingetuidgetppidgetgroupsgetgidgeteuidgetegidforkptyopenptyforkexecveexecvutimesutimeunameumasksystemnicemkdiropendirreaddir64closedirctermidlchownfchownfchmodttynameaccesssetpwentgetpwentendpwentgetpwnamgetpwuidmktimelibpthread.so.0libdl.so.2libutil.so.1libm.so.6libc.so.6__environ__lxstat64__stack_chk_fail_edata__bss_start_endlibpython2.6.so.1.0GLIBC_2.0GLIBC_2.1GLIBC_2.2GLIBC_2.1.3GLIBC_2.4GLIBC_2.3GLIBC_2.3.4         y] ii ]n]0ii ]ii ]^]@ii ^ii ]ii ]]0ii ]ii ]]si  ^ii ^ii ^ti *^ii ^ii ]ii ] $(,048<@DHLPTX\`dhĐ̐Аlԓ$,DPT\hltȦ̦ħܧ $D\Ĩܨ $D\tĩȩ̩Щԩةܩ  $(,048<@DHLPTX\`dhlptx|̫Ы<جܬĮЮخ`dhlptx 4`hlt|  $,04<@DLPT\`dlpt|  $04<@DLPT\`dlpt|  $,04@DPT\`dpt| (,\`| $(,8<| $,0\(<  $(,048@LPTX\hlpLXhl| 4H\p$<(,@DLPTLXl,8L| ,@\x|$<DLT48HLTlx@DHL`t $|  $,@DLPT\`dl@DTXhl,8x| X\pt @DHLPTX\`dhlptx| X\`8<@`t| @T\ 4<lxLX,8x| DX\`tx8<@`t| @T\ 4<lxLX,8x| X\`$8<@X`t| @T\ 4<lxLX, 8 x |       X \ `      $ 8 < @ X ` t |       8 @ T \         4 <      lxLX,8x| X\`8<@`t| @T\ 4<lxLX,8x| X\`8<@`t| @T\ 4<lxLX,0`dpt@D`pt   $ 4 ` p t           !!$!8!>>> >$>0>4>@>D>P>T>`>d>p>t>>>>>>>>> II,IXI\ItIxIIIIIIIIJJ JJJJ J$J,J0J4JECpĕȕ̕Еԕ ؕܕ  HkQ  G+  $ (,`04A8 < @1DrHLPTX\-``dh-lpt|x|_uWh+ĖDȖ ̖?Ж|ԖؖܖpoR(\^O M $(,0248=<@DHLDPT`XV\`dhfl|ptx%|a391Qxėȗo̗Зԗqؗܗ=EEb  $ (>,0A4!8"<@D#H(L<PT X\$`9dh%l&p;txP|1t'().?LĘȘ*̘+ИLԘtؘ!ܘ,q%-.0 1 =$(,2034d8<@D4H.LPTX\ `*duhFl:pEtx]|59 %} 6789R:^ę;ș<̙GЙ ԙؙ=ܙ>XT?@ B +$Q(,/0 4m8.<A@DHLBPKTX%\`}dChlp'tDx|EFGG]HbI>V JĚȚ̚КSԚqؚܚfX25K LMaN& B$(,048O<@DHLP!TX\`dPhl3pQtx|isRZ'"Sě&țT̛HЛԛK؛UܛBV{nW XxM Z$[(\,]0v4^8<<_@DHLPTX`\w`dhal"pHtbxl|,6c?RdefhĜjȜ̜6МԜ"؜2ܜkF^^n mno d$(_,t048j<x@lDHpLqPTEX\`d=h lep7trx|SrS.Fsgtluvt_"ĝȝ̝НIԝ؝3ܝPhT)U=  w  $x(c,0y4d8z<@D;HLPT{XM\|`Xdh~lptxG|kP0~X5ĞȞ̞&ОSԞ؞PܞuR{!bj0 f $(l,048<@DZH'LPTmX\`d#hTlpt@x|A"Fw[ ğȟ̟Пԟ؟ܟ7zeC g W$( ,D048<@D$HL2PTX\`Jdh_lp9tx|M\mcgĠȠ̠РԠؠܠ Uk\ h I$(,S048<o@DHLPTX\`dh>lptKx1|}8O{$Kġȡ̡С[ԡGءܡ 3fx ) $(,Y048<@ DHLPTXh\p`Ndhlp`txg|vI'.(\ĢwȢK̢CТcԢآLܢc<V U , $(,,048<N@$DH<LPyTX\`]dhlptx8|i7kQY@ģȣ̣6Уԣأܣ(qO6^o @ $(,048<@iD)H4LP[TX\`Od4h lptxg|ZlJe$ĤȤ̤ФjԤ!ؤcܤ5e> HZ ,$(M,0J4~8n<@ADHL&PTX\`dh]lp tqx\|p;US[t@X[ hhhhh h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhh h h h h h( h0 h8 ph@ `hH PhP @hX 0h` hh hp hx h h h h h h h h ph `h Ph @h 0h h h h h h h h h h( $h0 (h8 p,h@ `0hH P4hP @8hX 0<h` @hh Dhp Hhx Lh Ph Th Xh \h `h dh hh plh `ph Pth @xh 0|h h h h h h h h h h( h0 h8 ph@ `hH PhP @hX 0h` hh hp hx h h h h h h h h ph `h Ph @h 0h h h h h h h h h h( $h0 (h8 p,h@ `0hH P4hP @8hX 0<h` @hh Dhp Hhx Lh Ph Th Xh \h `h dh hh plh `ph Pth @xh 0|h h h h h h h h h h( h0 h8 ph@ `hH PhP @hX 0h` hh hp hx h h h h h h h h ph `h Ph @h 0h h h h hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h h h h h h h h h  h($ h0( h8p, h@`0 hHP4 hP@8 hX0< h` @ hhD hpH hxL hP hT hX h\ h` hd hh hpl h`p hPt h@x h0| h h h h h h h h h  h( h0 h8p h@` hHP hP@ hX0 h` hh hp hx h h h h h h h hp h` hP h@ h0 h h h h h h h h h  h($ h0( h8p, h@`0 hHP4 hP@8 hX0< h` @ hhD hpH hxL hP hT hX h\ h` hd hh hpl h`p hPt h@x h0| h h h h h h h h h  h( h0 h8p h@` hHP hP@ hX0 h` hh hp hx h h h h h h h hp h` hP h@ h0 h h h h h h h h h  h($ h0( h8p, h@`0 hHP4 hP@8 hX0< h` @ hhD hpH hxL hP hT hX h\ h` hd hh hpl h`p hPt h@x h0| h h h h h h h h h  h( h0 h8p h@` hHP hP@ hX0 h` hh hp hx h h h h h h h hp h` hP h@ h0 h h h h h h h h h  h($ h0( h8p, h@`0 hHP4 hP@8 hX0< h` @ hhD hpH hxL hP hT hX h\ h` hd hh hpl h`p hPt h@x h0| h h h h h h h h h  h( h0 h8p h@` hHP hP@ hX0 h` hh hp hx h h h h h h h hp h` hP h@ h0 h h h h h h h h h  h($ h0( h8p, h@`0 hHP4 hP@8 hX0< h` @ hhD hpH hxL hP hT hX h\ h` hd hh hpl h`p hPt h@x h0| h h h h h h h h h  h( h0 h8p h@` hHP hP@ hX0 h` hh hp hx h h h h h h h hp h` hP h@ h0 h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh h h пUVSvd$u\t$C)֋9st&9rƃd$[^] US0d$싓tt $Ѝd$[]Ë$ÐUi@]Ív'Ud$ȉ]u~}ۤ8ǍLED$ @@|$T$t$I@U@4$T$D$D$2?]u}]Ë $ÐUWVS>d$ԋEP@UExIEp@ ~/1 &vFt$FU9z ܃mxE븍d$,[^_] UWVSed$MAEEAŰuEvu؋p @EUčt&E؋qu@M$NjMq1~Uf@9uu؋VExn@}E)fuFmx5Q 4Wf~ƋUĉMT$$mMyˋ}U܅~'E܍@iM@ ;Ed$l[^_]fɋP ~։ωUv>uFtU: u܉T$$MMuʼn}}U^Ft pE+EE=t& }WE8UEOM0UuM*B 9tM}UTF@ ȉ umJtAD$XD$$RMUL$T$ MU L$T$@}ĉ$Nu'M8}kVzt:t WQt&ԋ}gA}܉M.t&U܍H ȉ ;Mt=q INQt9uv>iuϹ }uËE}܋봸fUd$]unuXF$o4$W]u]Ðt&Ud$ȉ}}]uq(G$`FtgTFǀ\FE $"‰XFFE䍆TFE UD$<$9MUt8y>GWA]u}]Í&<$xdvtAD$XD$$N붍t&4$1N릐UWVS|3d$ED$$BEUtÉ\FE UEEUčEuԉE`>EԋMϋ)9ʋUT$UFljD$ỦD$ EЉ$t$D$U UċET$UԉD$$4EMȅtUЅtCE}+}G$IE|$D$4$ָ1UԋB t.Uu&U؉B EE됍t&EEyt&u$ E UЉPU Ű\FUẺ$@U 1BF)ЋU B Ћ~ +>D$|$4$TWE 1Pt&Ú\FE̋XFǀXFŰ\FUẺ$4Rxt/$StzxxP@džx4$+d$\[^_]ËuԋU FAD$XD$uԋ$+E t&U 1똃~ U  AD$XD$1$ɲE 4$xHG$u :|$D$$U\U Ud$ȉ]u^u E}EUE$} E܉U ~FF FFFED$ED$E$Ptd\tB1҅‰9~U܉u UUU]Uu}]fhtf]u}]Í'USgd$̋E$EED$E D$ED$ED$ED$ ED$E D$E$d$4[]Ít&USPd$܋E D$ED$ED$ED$ ED$E D$ED$$Hd$$[]É'Ud$ȉ]uÞuE}EUE} E܉U ~FF FFFE$.thAD\:t=ǀ:~U܉u UUU]Uu}]t&h t荾1]u}]É'USçd$̋EEED$ED$ED$ ED$E D$E$d$4[]fUSWd$܋ED$ED$ED$ E D$ED$$ƺd$$[]Í&USPd$܋ED$ED$ E D$ED$D$$ud$$[]ÐUV1E Eu f^]ÐU1WVd$U}u U9Ex @8td$1^_]fd$^_]ÍvUWVuU} x1v  @9u^_]Í&'US@d$E$Zd$[]Ít&'UVSƀd$u4$t+0x)&R9u)d$ [^]ÍAE$E뿐S[U]Ív'US7d$0d$[]ÐUWVS^d$EԋU܋LM܋Q9Nt2}܋GD$D$ BD$X$衬LU܉BMԋ}ԋI MЋ}؉<$ E$lUD$D$Eԃ$M܋Ay@ljE8ABBEEȉUč&MUQ~ 19u f9 t{@9|O4$UMD$(ƋUM}ǁkỦMD$$M}EE9~a}EE9U܋M̉J4$d$L[^_]ËEԉMT$$dNj@;LM4]}؉D$ẺM|$$oM[B$D$ BD$ZB$D$\BD$8E؅~jUЍEu1։EU 9}؍v~C sU4$迥MD$L$$vҬ9}؋UurB$D$豬Eĉ$AMUN$zLB$jU܋}ȋBXD$ |$D$$裩MEԉMvGMAD$D$ (BD$X$Z&'UWVSE|d$ԋM0u<~11fQ2Bt99vd$,[^_]ÉȉMMސvBMD$$oM릐UWVS{d$ExCCUEjCẺUčt&UER ЉE0UUzODP_W8ˆE\t"w8E t E:G4D|$D$$nEEU9P5d$L[^_]Ít&E$ ỦD$T$$&뼍t&U$D$EȉD$$UEE4EU1@E؋rEE;}ԍv uЋFD$E؉$Huԋ t/$D$ E؉D$CD$eUEBEЋUЋUB$贵E@t&ED$'<$t4)EE$ E|$D$4$ UUB$'EpDRU؍1} v5|<$D$'uۋt!U؍9Ct$ T$D$$FE0U|$SC$D$UzvU؍DT$D$$Uĉ|$T$$ѧdt&<$耼E҉t$ɉT$ $ 3t!U?ɉT$ $蜾3uߋUB$D$CD$Wɉ $3uɐ&UVSÖwd$EU ~p19u Nt&9tD@9|ET$ D$CD$XD$$/C$a1d$ [^] UVSOwd$E 4@EpD$F$=Ft&UfUfPd$[^]Í&XD$Fǐt&UVSÆvd$uF D@D$F$FtQV RȉV @@@ @@+Fd$i[^]Ðt&|D$2F뜐t&UWVS.ud$ċEU ~Iu~1 t&v9}99uDU$ED$MUMuэd$<[^_]ËxvUD$<$MAUtvu4ȋEU$xF8uE+pd$<[^_]Ðt&4$xMD$L$D$ $CD$聤붍D$uUFnt&'Ud$؉}}]uètD@D$G$GtK R4ȉE E$FF FFF]u}]ÍD$bG뢐t&US`td$$t5@U@P@ @d$$[]ÍCE$E뵐UVSäsd$@D$F $F t*VЃV@+F d$[^]ÍvD$zF Í'UV4Shsd$p D$F$bFt#ЃU UPd$[^]ÍD$Fʍ'UWV֍d$E܋E}PU@EE UD$$E܉|$EU EEU E$E D$D$$UUUxqME0U}ԉEU؉΋EU؉D$T$E܉4$v0ED$$E UD$U$nmyd$@^_]Ud$EԋE]}usqPUpf> Vfft\ftVM~#U MD$$f~t]u}]Ít&U M]u}]ÐU.M "MUЋBD$D$Eԉ$ɤUM D$$iVt&E MD$REԉ$L$/t&vM UM $D$ED$ED$Eԉ4$kED$$E UD$U$fUWVd$E܋EU}PUpE UD$E܉|$4$EExXUEvU؉Eԍ&U؋EԉT$D$UE܉4$vED$$E!Emyd$@^_]Í&'UWVSl#od$E܋E$D$DD$葞E܅YEEEEEMЉEfEE9E܍v ~ uMEԉL$D$$,NM$L$U~C1 v9}~4sE؉|$D$$ɝ9}̍sB$D$讝FCEM1ɉu1ΐEĉM v PBA$U;ỦD$ B$D$ED$JM9q΃EE9Ed$L[^_]Ít& E$D$ 'UWVSUmd$ԋuEUt$$ntBUB 8py )x#vuFU$Eyt&d$,[^_]Í&UWVSl$d}8$袹EUhTBBB D$UD$$yGwEVED}ЉM؋}vf>FEP$U   E܉BBB BBD$GU$#GUBD$EUD$$螟UBD$BD$E0$Em"UE:}<$d<$E$$[^_]Í;E$EiM؉ $5GUEMЉE $UE$D$^ B$juE}FV W GEiEEEUMu;1/uM}M̋FE8UMBD$D$ $uE}̋F8E@EЉ$蜺UƋB$$EM1AAA }UOȃBtG$D$pFD$+DEEEMuuEű>}H4EfEċMEă}u 4>uԋEUԋERЉE0M̋yE̋@E;p@ 1EH9΍@ R9|Duȉ4$D$}̅GŰ}̋JIO4UFMЉ $FuV$U}ԃEE;(UEM;JűF~yEEt&}̋UW}؅\}1t&v;u؍AEЉD$D$$UעUtЉr}̃EE E;G|EEU9U9t"EuD$}ЋUE؉t$<$1EEE;}|uȅy;}E}U‰Ep d\ЉUE1҉}R9U@H uMq;pu߉ϋI;HuՅOMx}܋yM;yu}EE;yuEM̋Eԉű}U)u܋T;TTUT9UI @9EЋuċ}MA 8tUԋMT$ |$L$$试}~]EV u@F~911}v@;FR }N} ;yu}ԍ@y;FR |}EE9EvuE\MCu؋MU $vD$EUE؉BM؋}Ilj@@@ My Pu؋}u47u\quVUȋE$)G]}<$Uj}EU:t"EMD$uЋUE؉L$4$f}u1҉ R9U؍~&O uEU$+GU9U؍EF uT~~F11V: JL$ RMRTT$VT$UE$誎E;F|Nu-E}9}؍vE@U$DE?FMD$ D$D$ $M볋UMBL$D$$uFD$FD$FD$ FD$$ FD$~EQE}ԉEEU܋Muظ .}9qE;q*T$Dt$ |$D$$}E@ ƉuU~1~WUB$D$ M܋DL$D$$-Ev;0}~M$L$ 몋U$T$MEu;q'}G$D$ED$đuĉUԋ}PF$CUS@ad$E$jd$[]ÐUd$ȉ]uþaƋX}Ut腇NjE4$D$ED$臔t1]u}]ËE$٩¸u݃?t¸tȸ$袡}&yא&UWVSNad$ԋu$d褱EE $蜟\t$ XED$D$$融$dEd$EM $Τ E|0 FM\v<$DUD$衎NjUtDE 7$ȉMEMu> $^|7 t'V2}d$,1[^_]ÐtSEOx݃D‰<$D$d$,[^_]ÐED$$iUaM $腛d$,1[^_]fXt&뛉'UWVSE_d$ԋ@}9TE䋃TD$$<$4$uHUM <$T$L$NjE$%T$d$,[^_]ÍE $Ճ$荞tEU <$D$T$뜍t&1v#@T$FD$1$nUU]ÍUE ]ÐUEU ]Ív'U]3U%Yw I]É'Urz]EU ![w$F=t>#t &3]Ð=+ut&=u]Ít&=)uэt&=*ut&*$t='u몐t&=%u뙍t&=&u뉍t&/0w=(ggf=W>f<">>=**t&=,ft&'UEU /Mtg~%t&u>u=.u]Ðt&*t#v3]Ðd$<[^_]ËD$JD$$Ɉ벋EtA)ʋMЉL$4$xtԋ_udže4$1蟣rfUWVSN$@eE10`ul|OQt$<$IuՉNjUe3$L[^_]Í=dž9Gt+$]Njti<$;uO9)эL$$Äu G<$P:Dž~gxv@ufD$ FD$T$$Ѡ덐t&tu<$F@T$‰4$8ifʋT$D$$t1G<$PڋB$P^D$҉D$T$MD$D$ D$<$|$$ʧD$$?Gs vUd$D$ ]UæKu}JD$D$B$CteD$E D$$6~NjtQt=F<$D$蓛҉t@tU]u}]Ð]u}1]ÐF4$P뤐t&WE<$RE USJd$E @D$E$Єd$[]ÐUS×Jd$E@$'d$[]Ð&UWVS謰cJd$ċ~;~~ Vt~l,D$D$$vNjt?<$F tQ$ܓFFd$<[^_]ËNl+>}:$PF EFFP;x @ P@Vv D$$U,U;}NɉMU~$)ljE8E}D‹M؉D$ $wU8FT$$#M $舄EFF E+EF~ |$F Fz& $EljUԉD$ivUttU<91Ƀ}FIʉ)‰~ N4$}FD$$zFx 1Vt6)ʉU)ʍ lFFFd$<[^_]ÐEƐt&F pt&pFf hU؉$#M $FBv|V )‰4$TF D$$舟FP ED$ <$vf@Vu>F~d$<[^_]Ët$JED$F$FF $l@;t UԉL$$lUR<҉UB@W$m<$EUD$ T$D$<$|5J$UD$D$.UԉPQAMMԉEP}<$xt$ 1}ыE܍Q\x]MA $PD$$;F E$  V cMt^,$tc菝}D$<$ל9Ftp~BMԉ$PM`A $P뗋A $PF<$NE5FF E[}Uu B$PF뜍&'US萩GCd$܃tH;Hr9td$$[]ÍvJE $U}u}EEEE늍&VE܉4$RE릍&}uҍW<&Eu G<$PEd$,[^_]ÐMt؍WD$$'lE뵍E릍&Ku}uPRD$$kEjvEjF@ D$$RD$$$KIE:&USuçd$E D$ED$$7d$[]ÍUSugd$EM PBTtR4tRtL$$ҍd$[]D$L$$T7d$[]Ðt&USPud$E D$E$jd$[]Ít&US ud$E D$ED$$6d$[]ÍUd$؉uu]}tÈu]u}]]t&$ptt$$Ht6҉t]u}]Ít&P$R]u}]Ët1ƋG<$1P빍t&Ud$ȋE]'t }u} tsP;tX;ptP$Utj$q҉t]u}]fV4$ERE]u}]Ít&]u}]Ë]u}]7&$$H1t|$$h1|vUd$uu]}As U :Fx4tUOtNEȋEEET$D$ ED$4$ы]u}]Í&x8tYOtRE$D$8ET$UĉD$4$WUċ ɉ uJEĉ$QE뒍@ D$xRD$$$Eat&}16Uĉ4$ЅUy2} Eр}tEO&'Ud$uu]Eqx }U ENy4tGGt@MMɈMuyMT$L$4$Ћ]u}]Ít&y8}GtvE$D$7D$4$EWU ɉ uJE$QE뚍vU4$хUxY} Eр}tEG]A D$RD$$$C1?} 1(]u}]'&UWVSnp% d$EUPJ0tBTu}EMMċy9tw0utGTuiuEtsMԅtT$<$HREEċE䋻 Uĉ$T$M9d$L[^_]Ðu 1M|fM u9Mtu܅uUԅt)U$T$u; u҉KE@@TE@@T d$L[^_]ÐEUԉD$E$ҋ 9NMEMEt&t EEt&G<$P萍t&ED$E$61XEPR0M tvM$L$ҋM҉M҉UJE؉$QEwG<$PuEuEAfP$R҉t:UEP$RUJE؉$QEcEP$R븍&Ud$ȉuƋE]E}mcF} H0tX@TtRE tHT$U4$; Ut]u}]Ít&ɉuHU$QU}]}u]fUd$ȉuu]}m} VB4tEBTtP$t|$4$ҋ]u}]f@t|$4$Ћ]u}]Ív4$UtT<$]1tD$$d҉tq; u҉uP$Rt&F@ D$RD$$$l?]u}1]Ðt&]u}]&WE<$RE{t&Ud$؉}} ]ukÈuVB4tEBTtP t|$4$ҋ]u}]f@t|$4$Ћ]u}]Ív4$StD<$St8D$$\p; u҉u P$Rt&F@ D$RD$$$4>1Vt&]u}] Ud$ȉ]}jnNjE D$E$u; t ]u}]Ë҉t9F@ D$G@ D$ ED$SD$$$=1믋P$R뼉'US jd$썃 XU D$ED$$l)d$[]fUSi×d$썃 XU D$ED$$d$[]fUSiWd$썃 XU D$ED$$d$[]fUS`id$썃 XU D$ED$ $hid$[]fUS id$썃XU D$ED$$`)d$[]fUSh×d$썃XU D$ED$4$xd$[]fUShWd$썃XU D$ED$0$td$[]fUS`hd$썃XU D$ED$8$|id$[]fUS hd$썃XU D$ED$<$)d$[]fUSg×d$썃!XU D$ED$@$d$[]fUd$D$$\]ug?}u} ; t]u}]fVJ4҉tgt{F@TuBQuBWR T$@ D$ $XD$SD$$$>:1fQ t|$4$|vPM$RM눍&F됍t&'Ud$ȉuu]}fX} F@4t@t|$4$Ћ]u}]É4$NtL<$W1t׉$҉tY; u҉uP$Rt&F@ D$RD$$$,9]u}1]Ðt&WE<$RE떍&]u}]W&Ud$؉}} ]ueHuF@4t@t|$4$Ћ]u}]É4$Mt<<$Mt0$; uË҉u P$Rt&F@ D$RD$$$$8]u}1]Ðt&]u}]g&Ud$ȉ]}d^NjE$u; t]u}]Í&҉t9F@ D$G@ D$ E D$SD$$$p71먋P$R뼉'USdd$'XEU EM d$[],UScÇd$*XEU EM d$[]UScGd$)XEU EM d$[]USPcd$EU EM d$[]lUScd$*XEU E M d$[],USbÇd$QEU EM d$[]USbGd$,XEU E4M d$[]USPbd$/XEU E0M d$[]lUSbd$?EU E8M d$[],USaÇd$2XEU E<M d$[]USaGd$4XEU E@M d$[]Ud$$]u@a}u} ; t]u}]fVJ4҉tWtAt |$4$ʐG@ D$F@ D$ 6XD$SD$$$31덍t&PM$RM Ud$ȉ]Ew`.u}$} ?]1tJF@TubuCXSD$$U1҉uVE4$RE]u}]D$|$4$>fD$ D$|$4$1fUVS_vd$uVB0t?@Pt84$Ѕt@9tT$$Athd$[^]Í9tD$$AtF$2ƍd$[^]Í&4$D$x,ƍd$[^]Ít&F@ D$SD$$$$2t1bF4$1PRfd$[^]\Ud$D$ ]u^FƉ}E׉D$4$9uu]u}]ÐST$Eԉ$SEԋ҉t1]u}]ËP$R1'Ud$]}]îhuu\VB0t2@Lt+4$Ѕt@@T]u}]ÐBWh4$D$2 D$D$$'҉tWS$T$?PBVtpɉu$R4$KƋ]}u]Ðt&WEԉ<$RE똍&4$OƋ]}u]Í&@ D$SD$$$/t1F4$1Pt&t&OF@Tuzu/E4$D$ED$9?ukUE{vD$ FD$F $6:W8X$h14VF)"F1@ D$,TD$$$.&Ud$D$ ]u[6Ɖ}E׉D$4$Ft4>9uu]u}]ÐhTT$Eԉ$PEԋ҉t1]u}]ËP$R1'Ud$ȉ]uZÞl}utF;lP0t>RHt74$҅@@TF]u}]Í&@Vl4$D$/D$D$$$ƃ҉u G<$PS4$D$<Ƌ]}u]Í8X$lt&1KF$E7Ƌ]}u]Ít&"LF@TE4$D$ED$q<UE&Ɛv@ D$TD$$$_,8G1<$PzD$ FD$F $OYVFu}$MUt$6t8t]u}]ÍF4$P]u}]-t$T$#&tKU t'UB@ D$TD$E $+t4$DׁZv'Ud$ȉ}}]uWFGH0tN@VtHt><$UD$=NjUtM|$$֋]u}]Í&@ D$UD$$$O*]u}1]k,1ɋUu롍Ud$D$$d]uV}u} ; t]u}]fOVI4R4MɉtvNATuEBuEG@ D$A D$ CXD$SD$$$q)1놐t&B$t}]u}]cvHU$QUvt&EtUBtu뼋Nj&Ud$$]uUg}u }; t]u}]fWJ4VR4U҉t~t"Atu]u}]t&UtUBt}ҋF@ D$G@ D$ D$SD$$$0(1ZPM$RMnUd$ȋE ]Tnu}uVJ8t%ItD$D$4$ы]u}]ËJ4ɉMHy0tHAVtBt8$T$|:t||$4$0]u}]Ít&Ept6A D$PUD$$$']u}]ÍvB D$UȐ[4)¸ k&Ud$ȋE ]wS.}u}tu]u}]É$/Ƹtt$<$YC҉uɋV4$ERE]u}]Ív'Ud$ȋE ]RÞu}uUVJ8t*It#UD$T$4$ы]u}]ÍJ4ɉMHy0tPAVtJt@$T$8E|$4$D$NF]u}]ÐE@t6A D$PUD$$$5%]u}]ÍvB D$NȐs&,'¸gUd$؋E ]QNuta$!.Ƹt!Et$D$E$1҉t ]u]ÍvV4$ERE]u]Í&˹]u]ÍUd$ȋE ]Pîu}uVJ8tItD$4$ы]u}]ËJ4ɉMHy0tHAVtBt8$T$6|$4$ 0]u}]ËEp tNA D$PUD$$$e#]u}1]Í]u}]駸&B D$UT%1jt&'USOwd$E D$E$t7҉td$[]ÍP$Rd$[]ÐB1Ѝ&Ud$ȋE ]GO}u}u]u}]ʷf$+1tt$<$$҉t]u}]Ít&V4$ERE]u}]Ít&USNwd$E D$E$3At7҉td$[]ÍP$Rd$[]ÐA1Ѝ&UWVSNNd$UЉEԋuЋPJ0uċ~ɋw0ut BTEu̅t9upM1EM̅tT$<$!0}ЋEԉ}ċ UMċuȉT$L$$9d$\[^_]Í&GTtűM u9MsM1zU̅t2UЋ}T$|$$U; uEԋ}OQ0tJATtDM  ;Ut9;Ut4t0MЉ|$L$$; @Eԋ@@TUЋRBT}; OATI 1L$R T$ @ D$VD$$$u 1MGfEỦD$EЉD$Eԉ$ҋ 9MЋEԉMEAvEEЉD$Eԉ$0uhE; Eԋ}E}ED$E$[0Eԋ҉UЋuEЋP$Rt&u; WEЋNPEԋ@t&G<$P9fF4$PfG<$PuЋEԉuE8fEԋPR0(M  uMЉt$L$$҉ƋE&t&EԋP$R EЉE܋EE؍E؉D$E܉$A/uXUB@0M M؉$L$M܉L$ЉƋU܋U؋UtvUrEP$RaEЋPEԋ@R 1T$ @ D$UD$$$ F4$PEP$Ry=E؋P$RPE܋P$R-v'Ud$$t$VI EU uHATt%I0tIptBXE pMt&BXE Mu$t$]&'Ud$$t$HÍMEU FXE uM$t$]LUWVSHEd$ԋtU "1JATEMA;tU܉L$$kBUMD$ T$L$$ƅt VBTtbtu G<$Pd$,[^_]Í&EVA D$\VD$$1$럐Et4$ ҉t rt&V4$ERE܉XftU܉D$E$PU D$T$$EƋM؋A $Pt&D$$‰SvB UD$ B@ D$VD$$$t1F4$1PUB@ D$VFU܉$1tU]U܉$ UxMAU"9UҋUtoM $} U܅at $U܉M؉D$EU܋MtRT$UMD$$aM؉ƋtMEU܉$+U댋A $P؋A1 $PhfUWVS>E$dMu APP@V zFPP@V RED$ED$ $z¸t$[^_]ÍvED$ED$4$F E;EED$C$$wED$F$$tED$F$m$`E$?E1҅YRE9CUDž|1xt& 9u||xtk| t&UM $T$t$ǩEt$$0‹Ett$$0MtL$D$$` u4$t E$9=E$.=$1[^_]ÍVD$$$8$[^_]Ðt&ED$C$ #nED$ED$E$sEU1 8WD$$8E$Bd$ԋuEUEF4$9N‰EED$;"F$=V1~f@9F}FUE܍EE܉E܉~ tWU }Eאt&FUT$D$F$EЋU4$T$.V |$T$$m~ mu}<$y1d$,[^_]ÍUT$U T$$0d$,1[^_]@ čvUWVS@õd$ԋu EUEF4$9N‰EED$ F$E<N1~f@9F}FE‹UE܉~ tSU}EאFU܉D$ED$F$ҋE4$D$-V <$T$D$5~ mu}<$A1d$,[^_]ÍUD$ET$$d$,1[^_] čt&'Ud$ȉ]u?nu}4$} x]u}]Ít$$2x4$D$D$t:PBWu҉uVE4$REu4$׍$$@tL2E0$ a#RX$`xN؋0$tfUd$uu]}q>(EkF;pt @Wt"4$Ɖ]u}]Ðv4$E4$D$ &$r1EE1EDt&9-F 9tEЉL$ỦMȉ$ŰMu`EΉT Uԉ$^uuO9Uԋu B$Pu1UxŰu B$PEt҉u EP$RUԋuB1$Pt&蓥ƐE|$$UfUd$E ]D$DZD$$$@ ]u}1]ÐxXD$$$f.1]u}]Í&Ft&p|$D$V$Љ1xF9NNtHu)¸9~E]u}]ÐF UF]u}]ÐM봍&Bj} DF@TtB AXUS7Çd$܋E t&XD$$4-d$$[]ÍUE$ED$¸tՋEUEd$$[]Ív'UVd$܍UE$Eu D$¸tt Ed$$^]Í&US7÷d$܋EHu[U u,U$UD$&¸EEd$$[]fXD$$.,d$$[]faZD$$$,뮍&US`6d$܋E t&XD$$+d$$[]ÍEU$ED$g¸EEd$$[]ÍvUd$D$UE$E0¸EEÐUd$}}]u5hwt]u}]ÍvWEU$D$tNjEUE@ 3uԃx'uԉ}։v iCBR19u}Ћ@u3r1ƸDwU&XD$$$f*]u}]Í&G1v'Ud$E]u}4HP} ҋut-aZD$$$)]u}]ÐUMD$ $tf;}܍vFPP BUD$4$ЃUt'xX]t&]u}]ÍED$D$4$xЃuJEE81*YD$$(t&M $D$tGxTEt$|$$|t&;4t8YLt&{Ql?t&}맍vE̋U D$EЉD$EԉD$ E؉D$E܉D$$ED$D$4$;EuDt*}tDU~1M}4@ U9E1t&aZ`YyUD$U؋ED$$91rv'Ud$ȋE]}u1øP}GpP~txFtqD$<$Ѓt/xXD$$$-&]u}]ÍvE܍U$ED$u+]u}]Ð봍t&aZ돍ED$D$<$xu 1Ʌx M9M NM 1;M U9UNU)9u'1\MET$D$ $ 1?`Yt&Ud$D$]U/fE$Eu}u }1t(HHE9O9L)u|$4$.]u}]É'Ud$D$]U//E$Euu l1tx(;u}#uD$4$]u]ÍuZD$$V$]u1]fUWVEUS._d$ċ} $ED$Etd1MI9|Z$L$Et0ǃt$Et&D$E<$D$5 EǃuEԍd$<[^_]Ít&ZD$,$~#EEԍd$<[^_]ÍvUd$ȉuu ]}-xFxPGD$4$Ѓt-xXD$$1$"]u}]fE܍U$ED$tM܅u5]u}]f1]}u]Í&s1떍ED$D$4$xŋE$D$tU܍@T$UT$$ E܋U|$T$<>D$ }GUS,7d$܍UE$ED$1tED$E$d$$[]ÍvUd$D$]u,uEU$}} WGP0t@Vu7;4YD$$$Q!1]u}]ft<$D$tx7|$4$3]u}]tt&]u}1]Ð}čvEЉD$EԉD$E؉D$ E܉D$E<$D$xEЅ~]}tr}$&t}MЋU܅~1&  @MU9L$4$Eĉ4$EۤD$$oU܋E)UD$$St&'UVS_*d$EZHɍkZEыHt6D$pt$@D$ L$YT$$d$ [^]ÍD$HL$ @ D$T$Y$d$ [^]ÍUd$D$EU$Eu}uu}]Í&EU$E D$t͋EU9‰ENʅ~#9ɋu}(t |9U Ud$uu])ûFt҉u FP$R4$]u]Ðt&Ud$uu](kxi)vMF $Bt>P@P pP @@@]u]{]u]ÐZD$$1ȍv'Ud$ȉ]u(þ}Ɖ׋MxaBMU$U$T$ Mt#tpU P xHUP@]u}]Ít&$ZD$$]u}1]Í&Zΐ&Ud$D$$EU D$1 Í&Ud$D$$EU D$1Í&Ud$uu]}&Èxn9Ht+E D$D$ȉ4$]u}]ÍvHt΋x}t)}I}9}uUp룍t&$ZD$$1fUd$E]uU!&ؿHu IPt%ytItuE ]u]ZD$$$^]u1]Ív'Ud$E]uU%XHu IPt%9t ItuE ]u]ZD$$$]u1]Ív'US0%d$̋EEt3ZD$0D$$ y 1d$4[]Ít&ED$Z$CtڍED$ED$ ED$[D$E $tED$ED$E$듐UWVM USX$tJt 9s/u|[^_]ft@9wP[^_]f:tPߍ&'UWVM US#tJt 9s/u|[^_]ft@9wP[^_]f:tPߍ&'UWVM US8#tJt 9s/u|[^_]ft@9wP[^_]f:tPߍ&'UWVM US"_tJt 9s/u|[^_]ft@9wP[^_]f:tPߍ&'UWVS"ջd$E} ~S11} uTfM@;Et*M u˃u&M1@;Eu֍d$[^_]Ðt&볐tT띍vUWVS~!5d$Uҋu} ~`u_}v~CfT L@;Et$LMuML@;Eu܍d$[^_]Ðt&fUWVMu S Ï~N1vM@;Et) u܃tTM@;Eu[^_]fM&UWVS^ d$EuD$E 4$D$J}~,1t&t@;Eud$[^_]ÍUWVSåd$EuD$E 4$D$E~,1Tt&t@;Eud$[^_]ÍUWVS~5d$ԋU M|tf19щUs:1ɋuL@9Evu߃u"1ɍ@9Ew<$ d$,[^_]Í&ut&|d$,[^_]$ސt&UWVSud$u Mt~tb4119sB 1tDt&@9v u)uʍ@9w$_d$[^_]Í|d$[^_]Í$!؍&UWVSõd$u UtntR4219s8t6u%ɍ@D9w $d$[^_]Ë|d$[^_]Í$qؐUSPd$싃tǃ҉u P$Rd$[]Í&'UE tUR]Í&UEh ]Ít&UE]@Ðt&UrzEPt@]Ív`]Ð&UE]@Ðt&UWVd$̉E+E E} E U E؉UUE 1DuԈEẺf  uM8 D@Ru܉}̋uME1eE uU uM8Lt=u }uЍ@9E}͋MEȍd$4^_]Í&}E~>}4:u9UԉEЋU؋Mċ}t&F:vuI9UԋEЉMċM9Mt4u }kẼ9E3auuE؃E9E띍vUWVEUSx/d$ED$D$D$ E܉D$kD$E }ET$$*tRU܋B@Wt|J~K1&uTU܍v9r~1ET D$E$D$Au1d$<[^_]Ð|d$<[^_]ÍPd$<[^_]ËED$D$E$t$롍t&'UWVEUSXd$ED$D$D$ E܉D$kD$E }ET$$ tRU܋B@Wt|r~K1&uTU܍v9r~1ET D$E$D$!u1d$<[^_]Ð|d$<[^_]ÍPd$<[^_]ËED$D$E$t$e롍t&'U卤$X$]u1ƍE܉D$D$MD$ }EED$EhL$D$u]u}]Í&EE‹E@xӋ}~dEU܉EF}MuB`}9NЅ)x%ɉUE$] Eyv뿸ދEMEMNU܅ɋE`uu9Nх+U<7}uXxE¸HkSE1HEL$MD$ $*DžI;)NU m>u}u9uU{~GʹHSM:1E/ US0d$U E$1t t$]d$[]ÍkD$$f1Սv'USwd$U E$[1t$d$[]ÍvUS7d$U E$1t t$d$[]ÍkD$$1Սv'USǨd$U E$1t$Bd$[]ÍvUd$ȉ]}~u׋P;BTuC${ $i҉tf=w&]u}]Ív$8=vڍlD$$]u}1]Ãxt"lfVE4$RE뉍&@냍vhD$$$1_&US wd$E Ux#J9}$R$d$[]ÍJyِ=lD$$d$1[]Ðt&U1d$uu]B V tF;B}$R$tF]u]ÍvtF 1]u]fB$Pt&US Çd$UBtRD$$d$[]Ðt&`US Gd$UBtRD$$d$[]Ðt&`USP d$UBtRD$$d$[]Ðt&`US ǥd$UBtRD$$d$[]Ðt&`US Çd$UBtRD$$d$[]Ðt&`US Gd$UBtRD$$Ld$[]Ðt&`USP d$UBtRD$$rB Rv\BrRvFR1UuEP$R1E' t&Ud$uu]ëF ~DiD$$\Ft$F4$]u]Ív'U1d$ȉuu]}6} 9~Vu ]u}]ÉU>Uɸtۉ9|c9d}EUE؋orG1 D@fT$F$UvUt-F~V81nvWˋF~81UH'UWVUSRd$ԋEpE t=1~'UJU9uv99t99tE-u61d$,[^_]ÍlD$$d$,1[^_]ËUB)vT$T8T$$xEt$$yx 1vt&'Ud$]u^u}EE~D$lD$E $ttKExQ9F,lD$$]u}1]Ívu&1]u}]ÍFEx9F~ϋVE M׉)L$N$DD$b|$4$fxE׉$6둍t&lD$$&1l&Ud$]}w.}uEwD$ E܉D$lD$E $Dtt UEUuA1]u}]fxiD$$]u}1]Í&V<$T$UvUxE܅xE9|:P)ƋGL$Љt$$4WE܋M  cu1ȍ0E܅yE1릍Ud$ȉ]}W}UE uwdt@tHF<$D$x%GU0 ]u}]Í]u}1]ÐxiD$$^]u}1]Í&UWVSed$ԋM ɋuF} U Et} ;Eu{9~F~8u}} U~;׉t&JED$BvU܉D$ $'};u U|ԉփEd$,[^_]Ív#EEd$,[^_]Ít&F1EE Yt&F|$T$$릉u|$4$Ah$tuV@1҉~VF ]u}]Ð(jD$1$<]u}]Ðt&W$UFUt0Mu 8뎍vMU|$L$$jFUfu F4$PgX&UWVSӎd$ԋuE E1҉IIƅEuuh9AAMED$$dƋMEt.}@`E߉M؉|$D$$M؋Auo~`ul`}M؉D$T$<$^EM؅t,~uE`UQЋMU߉L$T$$hd$,[^_]Ðt&~Qt~땐F뼍vVPAt!QD$$rƍd$,[^_]Ðt&`Ud$ȉ]E^D$BmD$E u}u$~1tF}9|,t VD$$]u}]Ít&`)ljD$0$tɋPu`<9-u0몍vH+t뛍Ud$؉]uÎu}F$D$Wt*Fu2w`u/`D$L$$]u}]ËNwtыWҐU卤$HD$ D$]EDD$ED$JmD$E u}E$`u1]u}]ÍvE|‹EmxՁ}EUIE}@$D$:($蘹xEH<`tE1uM1xtf@;uꋵ&@=u~#Mf1@9DŽuꋍxϋtt& tRy䋅~+x4$L$|$Z}EE$D5&E@tEE[`jD$1$|$|1$&Ud$؉]unu}F$D$7t*Fu2w`u/`D$L$$W]u}]ËNwtыWҐUd$؉]u7u}F$D$跺t*Fu2W`u/`D$L$$']u}]ËWNtыWҐUWVSud$ EED$TmD$E $获E;  ]mUMEEU1@EzE~=}t&v9uUML$M2 $D$_uӉu}9t8x0uufxUED$:4$D$!u݋uG 9MUtUE$MEQ)UD$$1d$l[^_]Íd$l1[^_]Ðt&}uht&UxԋEUMEUM'UWVES+d$ED$dmD$E u$~#`U$5EȋUE;}ԉUt&MԋEȉEȀ  U&2< < v9+EԉD$EЉ$t[UȉD$$EQMu.9}Du;}cuԋU1U릋u A $PUȋtuEEȍd$\[^_]ËV&pU+Eԉ+MԅEHp9~܍PUÙ|  DuȍvA $POEϋUȋB$PEzt&UWVS>$DEPEUp` ED$ ED$rmD$E }$M#E9XM ʉM L‰$En1E1M9E` t=t&} v t&@9lj9|A9}* ufljEM>u9E9}}}+}EMx)L$$耵Ex} EM}@ t9}EEEp^}}#UE҉EU}fU JL$EUMF|E1EEUuM9E|JUҍru~=uTME80bMv9MT}M9E}uEu+E4$D$} }UG 4uEF}<$DE$[^_]EE$[^_]ËM9ME~UBE$[^_]ËEMxD$ $x}Gx<$PxEE9)E)ȍ D$ $"z} %UMB 4UEBCT}LE:L8ME||$D$ $x肪xP+uMEEt$xT$Ƌxta} UB U4E}MD$ $u4F4$P&UM $UE}D$<$ZF4$PMu A $PMuF4$PEM}MU } Lˆx$Exth}}1EEMMEEM}M:tE}: t)@99Uu}~u4$'+U}MUEM}L$<$蟰} -E}H UE9U~E+E~=UOD$Ex$xuuB$P몉ЋM)щ$L$ta} }UG 4E|mD$$<$0Eu B$PUE1E1WE1D$Ex$xu7Fx4$PxB$PF4$PF4$PMD$ $duKF4$PF4$PMA $PF4$PUWVSÅ|d$ EED$mD$E $螫E;  EE]mEEpxy )xED$7D$E$u݋ 9EtE$Ex<$vt$読d$\[^_]Ðd$\1[^_]Ðt&UpxEEEEEE_t&UWVSu{$TEPEUP.` ED$ ED$mD$E }$cEE9M ʉM L‰$EEEEuu yɋEx1I4$L$ct.} UMB 4EUB$yMEE$[^_]ËpUUxӋMMM>U MzLlj$zEME}Q)EEUMxMEPU~@UMdUtT>M8JdRy䋵tM4$L$.^} UMB 4UEB$,M $GE$[^_]ÅJt& >uy9lj|*vuu+uE|M)D$UD9$tEU7} @uMv x"u>u >tyuE}}uEUt$$U MuAU $PU덋EE9D$E$;]F4$POEuMD:D,EM$D$L$U5UdtE)D$ $;to} oMA M}E+}MuD$E$vuF4$Puu F4$PE$EUEE ƒ } ML‰$0EMo}+}E~MvM: >toylj4$|$!t3} UMB 4EUMJ$uEf)D$D>$趧Etǃ} 1EUM@ EjE+EO8EUD$$MuA $P뫍|mD$$u4$EF4$PF4$Pu4$/F4$PD$EU$*Uu$uB$PgB$PuF4$PE4UPB$PBED$E$u.F4$PUB$PF4$P Ud$ȉ]}îsut1D ;tvu]u}]fD$$Lt) ɉ tD 븐JE$QEt1럋G<$1P뒍t&'UVSOsd$ED$ ED$mD$E uE $1t-FU9| h9Nt%)$ED$d$ [^]Ðt&tVD$$eލv`USgrd$Pt@T$$/d$[]Ë`名&UWVSn%rd$ EED$mD$E $>E;  ]mUEU11RUUR҉U~1 fv9u~!Uu|$2D$E$u׉ 9UEtE$UBU<8)<$T$2d$l[^_]Ðd$l1[^_]Ðt&UxUEUUUHUd$؉]uGpu}F$D$Ǣt*Fu2w`u/`D$L$$G]u}]ËNwtыWҐUVSÆpd$ED$ ED$mD$E uE $蚟1t+FU9| h9Nt%)‰M$1҉L$?d$ [^]Í&tVD$$܍v`UWVS.od$E@EЍmD$E $EPU@@WŨ U܋U1h1Mfv9u|E܋B;Et&MUĉL$$ԷUu B@W`~}zy蟟M̋gEEȍd$L[^_]fA Eat&|$$ȠEt@`Eԋ}h1M-t&E؉T$UԉD$$v9uMMԋE܋z,z땐Et Tu7zARUԃEWU]1{t&UWVESRkd$ED$mD$E $pEtwExt{H9sxE1E< vt< uux)1I9#< u܋EЅ~1uu)yٍmD$$EEԍd$<[^_]f`1t$$hEtӋHE`P`9s1}̉< t#fI< t< uH1v;us< uߋEE~1uЋE)Džt1& @9u 뺍뵍vEԋHEPrEpmu"fUVSæid$ED$ ED$nD$E uE $躘1t=FU9| h9Nt5у)!)M$L$Md$ [^]Ðt&tVD$$ލv`Ud$؉]u7hu}F$D$跚t*Fu2W`u/`D$L$$]u}]ËWNtыWҐUd$M ]u}hhAuP0te@Vt_tUUԉD$ $ƴNjUF9F8$ƫ]u}]Ð;4t0kD$$$1]u}]Í&E؉D$E܉D$ED$ ED$F $D$襫E؅}N`$/M؋U~1  @MU9L$4$Eԉ4$荔EAUu9Ft&=lD$$1 t&~i1ۤD$$蓘D$FE$|t&UWVSufd$ԋM E} U pt} 9uo|$$Et`t\E 11tHu֍vUMBQML$T$$<u9} ԋEd$,[^_]CEEd$,[^_]Ít&D$$茗EEd$,[^_]Ðt&UMBQ|$T$$ Ed$,[^_]Ðt&UWVuSPe$t}EEUE EED$$ܖ1t7UċGT$UT$$+UGT$EċU$T$}tE4$E}tUE$E$[^_]ÍU B@ D$ G@ D$mD$$$ϝ1뎍v賔$[^_] US`dd$싃h$G1҅t@@@@ d$[]ÍUS÷cd$ED$hD$$蘕d$[]É'UWVSucd$EEԋE $肬EMQum`E܋Eԋ@Eum`҉Mum|mD$$EME؍d$L[^_]&MEԋIM܋@EtEԅҋ@EtU$nE؋Utu)ut&mu}uĉ9uuċM $Ủt$@M؉A EAŰE)U$D$U؉BݝM؋t`EvA $PE؍d$L[^_]'&U؉B BMԃJt&d$L[^_]ËU؋B$P뒐Ud$]EÎaEE u}$蜪ZHucE䋓`@Eu``ɉEu`|mD$1$]u}]Et&PE@EtEɋ@EtUԉM$虺NjUԋMt$E܋UL$D$k‹MxrD$E܉UԉM؉$uG wUԋM؋E)M܉ $D$PG1tL1F4$PfEG GG]u}1]ËG<$1PUщWVS*_d$} 9E1҅Et!UM{M-EUĉE1ɋFIM;}M9OȉM)M9U~gU茬Uu-}tEM$肿Mȍd$|[^_]Ít&F+END$EȉD$ȉ$ݵFU+MȉUD$4$ќUx9U}-FN))ЉD$EȉD$ȉ$葵U1ɅV~ET$D$<$19EE1G@ D$4kD$$$ח<$UbƋMEʉ$t$%҉VE4$REfUWVS.]d$u FPPt6@V t0Bt)EPt$$tK d$L[^_]É4$hEt*D$ 4$豬Eu!UЋ|1d$L[^_]Ít&E$D$%Et׋x`U̍U1UfUЉ$%UĉiteŰE:t>9}DEԉD$Eȉ$觚x?Uȋ`E̋rtBE눋F4$P뷐t&u F4$PUЋUfEȋ@E0fUЋtTEȉ|$$xŋEPEȉD$E$'UȋRB$PDB$P롋B$P1vvB$PXfUd$ȉuu ]}è[}Ex0W9}1uUF$D$]u}]ÐWy̐=lD$$ɍ&U蠲¸tGU01]u}]Í'UWVS>Zd$} uMGP0@V<$UMD$:NjUM|F9}EE}1U;U~Utx/E9ɋU~1uĐu @v U9Ed$|1[^_]Ðt&;4tP\kD$$$趵d$|[^_]9M1~FEL$|$$1АE؉D$E܉D$ED$ ED$FMD$<$蒝M9 Ah9tMT$$ˡMyE܋I3U;Ut&ÔUMuQFo=lD$$蹴VE9 )ʉ4$T$蠖UԉtFUԈ81D$ kD$L$$} $vtD$|$4$E7U ɉ LJE$QE8:RE܅M؋}11@ND$UD9D$) $袮E܋UǃM9NM 8MċM9MrE)묉M輤MU9YFMȉ4$)ЉD$LM9MF+E)ȋVD$EЉD$E‰$MZFU)ЉD$EVȉT$F$֭U؋MyE1v}M؍WUQ׉E܉}~)‰T$)ljT$<$vM؋VvUWVƍd$E9ЋMuR9UNUUEd$ ^_]Ë} t+E EExߋEU} 1UE}u9E|u܍AU:u} ω}D>}u EUۍA:T7uNjUuƋ}9҉umME]E뜍t&8I' UWV֍d$M9΋U Eth)щMxZMu@ uMUJMt&U:PuuUL0:L2uM9ɋ}tEu9u@}EEd$^_]Í&sHd'U卤$]EûTD$E܉D$ ED$nD$E u}E$Ƀu1]u}]ÍuE+xڍ}E܉EUM䉅l`EUphE@~pUR҉dt`lGp Ed@L$ lhp$lT$L$o vEH4$貳<$誳HOltËURЉX9Nlȉpʉlp9Љh\XPL$$Ʉ\\1SMIE`t\Q9`l`$DL$D$ЕDldh҉pT l1҃PhdL։ϋt2vGl`<$L$D$Kh9pƋph‹PLtdX+TD$tdL$$\p9lpEd@L$ Xhp$XL$T$l+pTЉЉtT9|tdjHD$$輂T1THATz/TRtXdP\dXLet)t$T$ $D覓Dt֋l`4$D$T$|ltpddh\)p$T$L$E<9Sl`tT$L$$lptx4$ȯ1lEd@T$\hl$D$d\HlHdHD$$t1tHhtz`dHD$\$DD$DlЉ\pD$`D$\$đHtDɉl\dpd\DpL$`DL$$ZllҋD~5p֋h\)p$T$L$-udt-hUhR`d\Xp`Džl1t&v9@ph)‰L$T$$ĩuЉll\Xd+lD$$~t1t`txtQd`hp+`L$$D$Hl‹Ht`+`4$L$DHD$虏DHΉ`lmp+`dL$`L$$ItnX\+XXD$tPLL$$T)nD$$_17n݋URt\PhUXRhdT\hDžpp;p@\X)‰L$T$$zuȃpTIlpȉTʉT9pd L$$d|t1ttz6`dh։TN‰L$)ʉ4$T$DyD`֋lL$4$T$UlOpp\ $)ȉHD$XD$SNjHtj9ll`4$T$D$Hl놋`tlX\IT|\)ȋdTD$L$$wtpd‰D)$L$zt1tDZtxv`ld҉dR\`]l4$l+lT$DHD$赋HpDl`օ~>`hdp+l$lT$L$tl\dl+lT$D$ $)tN`h`UpdRD$lplT$$H hHdHT$$,y\1\H\x\@tdlT$t$HD$:h+lt`ƒtdHtЋ\l:t$)‰HT$pT$Ht`@IltHtPfDžTctQ`I`tdUd$EP1t E$D$U Í&'Ud$UBtB҉u P$R1USwEd$UBt Bd$[]Í oD$$1ې&USp'Ed$UBt+D$ @@ T$D$lo$+d$[]Ít&.oT$$d$[] Ud$]uîDu uIEPt'Nt L$$]u]Ðt&~]uЉ]ÍoD$0D$$6¸y몐UVS_Dd$uFP@N V@BFFt҉u FP$R4$)td$[^]É'USçCd$ME 9QuDQt҉At t1d$[]Í&B$Pd$1[]ÍBoD$$$ڝ뽍t&'US`Cd$U9BuBtBd$[]ÍvBoD$$zd$1[]É'UVSöBd$u$賅tHptp~t}lE$諞EdF H IN1rd$ [^]ÐUd$ҋtɉt tÐt&A $PÍ'UWVd$u} FtU$T$ׅurF tU$T$ׅu[FtU$T$ׅuDFtU$T$ׅu-FtU$T$ׅuV1t E$D$אd$^_]Ud$uu}} FtU$T$ׅuV 1t E$D$׋u}]Í&UWVd$u} FtU$T$ׅu,F tU$T$ׅuV1t E$D$׍d$^_]ÍUSç@d$싓tET$@${d$[]fo$bg‰1uٍv'Ud$ȉ]E 臦>@}}u7E䋃(4$D${t0U$T$蝃u9]u}]Í&0$`{t'D$D$4$EpUt; ; A@W $MM $MD$ÚM $D$讚U M1҉A $P1v҉A $PFM4$PM&t&BM$PMt&u A $PDtD$$$2do$:e(> UWVS^>d$ԋ} 9}t:G@WtBGE~M1 t&v9u~=D UD$$dtd$,[^_]ÍvEtU9Bt d$,1[^_]ËB$5E~1 fv9u~ՋUt$B$$|$bdt닍t&Ud$ȉ$]}脣;=׋UuT$||$$貀tdD$D$4$m҉t-҉uVE4$RE]u}]ÍWE<$RE&t1ƋF4$P1빍t&0$xtϕ 둍Ud$]u臢><Ɖ}UEU }E܉U}䋃9Ft ]u}]Ðt&(jD$4$Vw~}$|$EhE؋U*E؉$UD$D$lE؋88UyR; n; bA@W $MM $MD$賖NjMЉ $D$螖E؋MЋG;FN@B B d;U U؉|$MЉ$}׋MЋj ҉QEԉ $REt&tH1lt%DtD$$$#1:t&A $PЋB$P1t&BMЉ$PMt&xMЉ$WMЋUpu A $PU܋]U}Uu]pE؉MЉD$<$UҋM;E܋U؉$:Mfo$j`(z1St&0$t裒ZoMЉ$ME1 vUd$D$]}?8NjE EEu$uUt$~; t]u}]Ð҉t-Eu EEE]u}]7&P$RȐt&US谞g8d$싃D$U oD$o$E%d$[]Í&'US`8d$싃D$U oD$p$Ed$[]Í&'US7d$싃pD$Jp$Ed$[]Í&'USМÇ6d$싃TD$U UpD$ap$EEd$[]Í&'US耜76d$싃D$U lpD$xp$Ed$[]Í&'US05d$싃D$U pD$p$Ed$[]Í&'US×5d$싃D$U pD$p$EUd$[]Í&'US萛G5d$싃D$U pD$p$Ed$[]Í&'US@4d$싃D$U pD$p$Ed$[]Í&'USç4d$싃D$U pD$p$Eed$[]Í&'Ud$D$]E菚F4E uEEE܋Eu$E}t$; t]u}]f҉t%E܉uE EE]Eu}]P$RАt&US÷3d$싃D$ U oD$oD$p$Ed$[]Ít&US谙g3d$싃D$ U oD$pD$p$Ed$[]Ít&US`3d$싃D$ U pD$pD$p$E{d$[]Ít&US2d$싃D$ U pD$%pD$p$E+d$[]Ít&USw2d$싃\D$ U -pD$6pD$q$Ed$[]Ít&USp'2d$싃D$ U >pD$JpD$ q$Ed$[]Ít&US 1d$싃D$ U UpD$apD$q$E;d$[]Ít&USЗÇ1d$싃D$ U pD$pD$%q$Ed$[]Ít&US耗71d$싃(D$ U pD$pD$.q$Ed$[]Ít&US00d$싃`D$ U pD$pD$7q$EKd$[]Ít&US×0d$싃HD$ U pD$pD$@q$Ed$[]Ít&US萖G0d$싃D$ U pD$pD$Iq$Ed$[]Ít&Ud$ȉ]u7/u; }E} u4uURqU [q]U}][q$T$t$|$$EsƋU$UD$D$3`U ɉ tE҉t]u}]Ðt&V4$ERE]u}]Ít&1ʍt&JE$QE몍&uՋB$P1떐&Ud$ȉ]}î.}; uMU cqUD$ $M~ƋU|$T$$qD$D$4$!_҉t.҉uWE<$RE]u}]Í&VE4$RE&D$ RqD$[qD$cq$Z]u}]Ðt&t1녋F4$P1u0$it׆UM}U M]u}]O US耓7-d$싃 D$E D$E$|d$[]Ív'UWVS:,d$ԋ4$D$Eh|$$[pD$D$4$}]‹ty; tA$UrU ɉ d$,[^_]Ív ɉ uB$Pd$,[^_]ÐFU4$PUst&GU<$PUQȋt7d$,[^_]Í&JE$QEHt&RF4$P?v#gt׍ltD$$$%lq$-RNef0$fKk'US0*d$싃 D$E D$E$dd$[]Ív'Ud$؉uu]}Ø*~GUu!E D$F$e]u}]ftUE <$D$t‹PBUu]u}]ftNt$L$$ҋ]u}]É<$U1y뀍&Ud$؉}}]u!)G t#${xƃu,]u}]Ðt& $RxՍG$=xt1ƸD뵾뮍v'UWVS螏U)d$ċEP U䍓 HT$@U؉Mԉ$|yƋU؋M@@WFE1ɍ>Et=T$ $>y@@W҉x>1EEU$wt@@W ɉ 1t҉t҉uWE؉<$RE؍d$<[^_]Ð>>>1E GEEeEU܉D$T$tq$+ksVE؉4$RElt&BD$ E܉U؉D$ED$q$jU؋ ɉ JE؉$QE t&$P1v4$U؉M1P>U؉E܋MM<$1P>U}0$bu1&s>U؉E܋M0$btF>UUd$؉]uþ&u }}FD$G$5|uW N 9tt#t/L$$|]u}]Í9s ␍t&]u}]ÍUVS6&d$uFP@N V@BVFt4$tVtbF t ҉tpFt ҉tN̶=!@V ̶d$[^]Ð4$Ud$[^]ËFP$RfFP$RfF P$R낍v'UVS菋F%d$uFP@N V@BVFV toFt҉Ft ҉tFt ҉t]Ft҉u FP$R4$Td$[^]Í&F P$RfFP$Rb&FP$RfFP$Rp&FP$RF&UVS_$d$ҋ̶t&t&J $OT̶uލd$[^]ÍUS÷#d$ed$[]ÐUd$ȉT$]uӉÊ#}UƋ@ $itE0]u}]ËF${E~1ɉ}܉ fv9u~%t$G$~U$Ust׉륋}렍Ud$ȉ]u7"Ƌ}}<$2F<$Fn <$FT]u}]Í&Ud$T$]u賈j"}Ƌ@ Uԉ$yhNjUt]u}]ÍFM $t׃@@UtˋtVt$T$<$Ћ҉t 뢍&W<$EREԉ눍'Ud$]}î!жuUĉƋU2FH4$D$\ƅM$L$dD$D$4$R҉t<҉t]u}]Ít&V4$ERE]u}]Ít&WE<$RE볍&\uV ]u}]É.7&t1mF4$P1]0$\ty돍qqMЉEԉUqME$qE܍qEqEpljжUMjȉuM1MU$F7ж7>vtU2ԋuU)&Ud$ȉ]MÞ}u9yt_ U 9zt@]u}]ÍvUDʉ$E 9uӋuF4$P봐t&EU $ȉMU M9uxF4$PMg&Ud$ȉ]}}uu t$G $dt]u}]Í&GU$]u}]Ít&'Ud$ȉ]}规^}uq<$D$ntz@B B d;GE4$D$E D$rj ҉uVE4$RE]u}]Ít&q$w1u롋0$HY1t wG@$DD$tD$$W1됉'Ud$ȉ]E 觃^u}$DE8_t"U EtS]u}]Íx_uع y WuuUBBt뮐XUBpu]u}1]Í&0$8XtuE UD$T$$%`tD$D$4$KM҉!WE<$RE buGUB B ?UED$ B@@D$tD$0$}UtD$$wUd$ȉ}}]uøu4$D$#E |$D$$ _DžtVD$|$4$2L‹t]tlt5 1ɉ u-B$P]u}1]Ð]u}]Í&FU4$PUuGU<$PUu븐 q$Att&q$jAk&E $D$]F4$P7t&'Ud$ȉ]uW}D$E$xE $D$s]D$D$4$J҉tj҉t]u}]fW<$ERE]u}]Ít&W$R@U]u}1]Ðt&VE4$RE҉u딍t&uF4$P1f'Ud$ȉ]}'u}lD$<$H E $D$C\D$D$4$eI‹tpt5tI$UJU ɉ ]u}]Í&GU<$PUut&]u}]ÍFU4$PUu봍t&uF4$P끐t&JE$QE]u}]Ë0$,StpE D$D$<$?Ot&q$B>x&UWVSn}%d$ԋ}HD$E$uuE|$ D$E D$*r$fDžtD$|$4$G҉҉tX1҃ɉt\d$,[^_]ÐPuD$0D$$Nbad$,[^_]ÐP$R1ҍd$,[^_]fWE<$REgt&VE4$RE҉EȋD$E$;!t*uD$0D$${a3ED$E D$r$'er$2<*F4$P0$P_nD$E$jED$E $@D$|$%r$dr$;W0$P?mteD$E$ED$E $V@D$r$cZq$: q$:zvUWVSzd$ԋ}u4$D$#E |$D$0r$@cDžtRD$|$4$6D‹tQt`t1 1ɉ u)B$Pd$,1[^_]Ðd$,[^_]ÍvFU4$PUuGU<$PUuq$9tt&q$z9s&E $jF4$PGvUWVS~x5d$ԋ}D$<$8uhED$E D$r$aDžtpD$|$4$B҉tg҉uWE<$REd$,[^_]Ít&uD$0D$$v]nt1뺍&VE4$RE눋F4$P1f5r$81p0$Lt\jtAD$<$nyED$E $҉t]u]Í&V4$ERE]u]Í&Ud$]uws. ut]u]Kvqr$3‰uӋ]u1]fUd$]us ut]u]vyr$3‰uӋ]u1]fUd$]urn ut]u]vr$23‰uӋ]u1]fUVS_r d$ҋutwT$4$[Au/t=S$T$Td$[^]Ít&d$[^]t&8X$2‰1ufW$r2‰1i뚍Ud$]uqN ut;D$4$@uu]u]f]u]Bfr$1u]u]Í&'Ud$]uqþ ut]u]vr$1‰uӋ]u1]fUd$]up^ ut]u]{vr$"1‰uӋ]u1]fUd$]uGp Ķut]u]vr$0‰ĶuӋ]u1]fUd$]uoÞ ȶut]u]vr$b0‰ȶuӋ]u1]fUd$ȉ]uo> }uD$4$D$D$<$9ƋtAt}F@V4$XO҉t-]u}]ÐG<$P봐t&VE4$REr$q/Gv]u}]Í0$CtaD$4$0$Ctba:҉t% vD$$$c 4$PӍ0vD$$vcBr$~.O vUd$؉]um^$}D$E$tJD$D$$8Njtta]u}]fF4$Pt&rD$$1$bf$-1$c럋$0Bt_넍'Ud$؉]uln }}M <$D$D$D$$6NjtetGxTyPpt]u}]f@ D$PvD$$$G?t$1]u}]ÍvF4$P됐t&G<$1P]u}]ÍW$Z,1랋0$@t^<$D$tH҉t2<$F^r$+ 12P$RÍrD$$1$`&Ud$]U jÞ$UЉu}+EԀ8_UtlE$E@@Ut3t)U4$T$D$ЉƉ]u}]Ít&]u}]Íx_u ytA utO uUEpD 낐t&Iu[UB r cUBrLUԉT$ UBD$vD$0$<vD$1$_vUd$ȉ]E giu}$r*E8_tZUGUBpE;MEU D$T$A $WfƉ]u}]Íx_uU $;M|_u|_u yu WuTH}U9BMuAq҉1Ef}}UM |$T$ L$$|EDž]}u]Í}GpfuM L$F $L}E D$ G@@D$tD$0$:} E|$D$$DU&D$|$4$1҉t*P1$R'WE<$REGul}t^UB@W tRMuA q \wD$$$b\0wD$$C\wv׍Ud$ȉ]}f>u}D$<$D$D$$0NjtiG@TuMwD$$$[҉uWE<$RE]u}]Í&<$P<ʋF4$P댍s$_&5]u}]Í0$:tXܶD$<$t<҉t&sD$$$Z>fP$Rϋ$[:cXضtUD$<$0u$*:2W<$E@q$b%ܶClq$A%ضuv'Ud$ȉ]}gdu}D$<$tBD$D$$.҉uVE4$RE]u}]Ív0$89u1VGkPL$@ U$QUƅt B@W>t F@Wu?,s|$T$$n@q#s$$1MU4$j$UD$|$ BsT$$@ $@$xUd$ȉ]}cþԶu}D$<$(tBD$D$$b-҉uVE4$RE]u}]Ív0$7u1U}]u}]&Ys$#ԶX1또&Ud$ȉ]u'bu}kD$F $eONjFt PBWus>t G@Wu(t$asT$$>]u}]Ðt&<$U"Ut$ D$T$ts$>]u}]Ív$"뇍UVS_ad$E D$E$B)tWEM 9pQ9tO҉tbU  ɉ uB$Pd$ [^]ÐE9ptJM 9q‰uE뚍&EP$Rfd$ [^]ÍvM 6~M EQRvU ɉ U ɉ [JE$QEGU ɉ U ɉ ڃMt&L$$_d$ċu~GGVFWPNFt4$GE܉D$ED$E$ERtDD$D$$EL)UaɉE܉D$ED$E$Z>tOt}l$9TdGVRW:xd$<[^_]Í&$`NFuVt;F t ҉t4$(d$<[^_]ËF P$R4$'fFP$RF uvB$PfHUԉ$QUt&s$"‰4$7u&$7U&Ud$ȉ]u]}=(E $E8_t=uMEU D$T$A $ZƉ]u}]Ðt&x_uU $.M|_u|_u yu}wtEPwBW 18tD$$$QlUE D$B $;AM}ML$ GD$vD$0$#/wD$$IQ u}w9EPwBW#U$MKM1A 9Pt!dv9'MD 9PHMUL$$Ut̍xu䍃 4$D$Uux}Hx}WBW}1Uэlx;J\EۤFE UE;ۤ%M䍃s $D$cUtgu䍃s4$D$JUt;}䍃s<$D$1U~ N OۤDžnothDžing$DI‹$>3D$yD$$|$L$t$T$ $T1fUe3$L[^_]Ít&4$B=Ǎ@$U>P ~1ҍvL tR9L uƋT$t$$8҉eV4$RKv|$ $4|t!t&떍1# gW $D$4u =yʉ#uG<$Ps(Ud$uu]I;FtV tT$V$Љ4$;]u]ÐV$㍴&'US0Id$Et 9Pt#zD$$$>1d$[]ËPu֋U Pt&USHÇd$Et09Pu @ d$[]Ð{D$$$>t 1d$[]Í4{D$$$=1ۍUSPHd$Et09Pu @d$[]Ð`{D$$$=yt 1d$[]Í{D$$$r=1ۍUd$ȉ]EG~u}$":1t5E 4$D$11t<$(҉t8҉t ]u}]ËV4$ERE]u}]Ít&WE<$RE҉učt&Ud$؉uu ]}Gt>G$-$|$*tUPUPp ]u}]Ð{D$$$><]u}1]Í&Ud$]uF>F$-$t$c*tUPU P@ ]u]ÐUWVEp<@8~V}v9u }z&?;} '1zt }7zIɍz;u EDž #Rx :ztUr^_]Ë}G^_]1뺉'U‰WVSlE#d$ԋ@EU܉$8NjUtiE~b}16&BWtZP@T$$UD v9u~!D P;uƒUD v9u߉׍d$,[^_]ÍvB }D${D$$$t1d$,[^_]Ít&}ߋG<$1P렍Ud$ȉuu]}aDF}U v,l ]u}]ÍD9Gu9BuD$B4D$G4$Uc9UIG;BFG ;B :G;B.G8;B8"D$BD$G$9UD$BD$G$8UD$B D$G $8UD$B$D$G$$8UD$B(D$G($z8U~dD$B,D$G,$Y8~FtO|f0|D$0D$$n(j1lt&uuP믐Ud$]uwB.u}F4$*u]u}]ÍF$*t֋FUԉ$*EtF $}*EtF$$j*EtF($W*EtF,$D*UnF 3F3F113E3E3E3E1ȃDHvUWVSA@$EeU1ҋP8 }DыH0t yIGWEx4 }t)O }GWET$t$D$L$ d|D$D$4$4$|Ue3u $L[^_]' &Ud$؉]u@^u }}F4D$G4$/uG+FtD]u}]ËG +F uߋG+Fu׋G8+F8uϋFD$G$/uŋFD$G$p/uF D$G $Z/uF$D$G$$D/uF(D$G($./iF,D$G,$/R&UVS?fd$uFt҉Ft҉]F t҉/F$t҉F(t҉F,t҉F0t ҉t{F4t ҉tYF} uuG;pp$T$DXW;D$$u|$D$$G;ptp$T$"GGuG]]ȉ<$PEE^&GG FGFGF ]u}]D$<$uX<$^΍&D$$$u G<$P^댐t&~<$D$D$Ff~$DfUS wd$E]$E]Mt)pPEXEXd$$[]Í&UVS_ d$EHMP Upu@E $E]ED$ET$D$ d$ [^]Í&Ud$]}î} uuU؋OL$O L$OL$OL$ NL$N L$NL$ NL$Eԉ$Eԃ8!t3E؉$E܉D$ED$ED$ []u}]Í~D$ $1fUd$uu ]}]}иBHT9tZL$$uHp@9tT$$¸t1f]u}]Ív$]؋E؉$E܉D$ED$ED$ S1]u}]Ðt&$Puz]EȅҸt됍$HEEwt&USçd$Ep9Pt'P$P T$PT$@D$ d$[]Ãd$[]Í&'USGd$܋E@]@E$ED$]ED$ED$ Bd$$[]ÍvUWVS>$tD$0D$u} $1OL$O L$OL$OL$ NL$N L$NL$ NUЉEL$$E8!dE}E% fEmm]ЋUЉT$U]؉T$U؉T$U܉T$ WT$W T$WT$ WET$$d$UT$UT$UT$UT$ VT$V T$VT$ VT$E$d$EЉ$EԉD$E؉D$E܉D$ NjE$EĉD$EȉD$ẺD$ ƉD$|$$t ҉t/t ҉te[^_]ËV4$EREe[^_]ÐWE<$RE&~D$ $1fUSǴd$܍D$0D$$y1d$$[]ÍE D$E$vtً@  ɉ uʋJE$QE빍&'UWVS~5$tD$0D$u} $16OL$O L$OL$OL$ NL$N L$NL$ NUЉEL$$E8!E}E% fEmm]ЋUЉT$U]؉T$U؉T$U܉T$ WT$W T$WT$ WET$$d$UT$UT$UT$UT$ VT$V T$VT$ VET$$*d$E$EĉD$EȉD$ẺD$ e[^_]Í~D$ $n1fUWVSÅd$u} 8IOL$O L$OL$OL$ NL$N L$NL$ NU؉EԉL$$mEԃ8!tZE؉$E܉D$ED$ED$ "e[^_]f~D$0D$$1Lƍ~D$ $n 1fUVSÆd$U EMrt$r t$rt$RT$ PT$P T$PT$ @D$ $d$E$ED$ED$ED$ Ge[^]Ð&UVS?d$U EMrt$r t$rt$RT$ PT$P T$PT$ @D$ $d$E$ED$ED$ED$ e[^]Ð&UVSfd$U EMrt$r t$rt$RT$ PT$P T$PT$ @D$ ${d$E$ED$ED$ED$ 'e[^]Ð&US ׯd$E]EE$E]D$ED$ED$ d$$[]Ív'USÇd$EEUUE y]E y ^$]EuE$t#E]E؍d$4[]Íكȁd$4[]ÍvE\$$9UE y]E뱍]"E또t&US×d$܋EP$P T$PT$@D$ b]J8"Et$d$$[]Ív؍~D$$ 1֐&UVS_d$E EuEE$uz!]؍v؍uz&& fT$$]]]]UE\$$]E\$E$EEٍEU$T$ D$EMEM^d$p[^]fVuzv.f!&ɍ뙍t&끍t&$])}]E$HEE,UWVS~5$4EpP9tt$$4EPUP UPU@EċE P9tt$$[[E PUP UPU@EE; EEuRzVٽvv ft٭tەp٭vppۅpt& ɍ]ЍE]ȋUȉT$ỦT$UЉT$UԉT$ UT$UT$UT$ UĉT$$E݃Ёw݃؁]& f؍t&"D$$>1e[^_]Ít&.ɋU}dUUċMhUPd}M؅eD$dU؉D$lhl<$L$T$ t&UEEQt&!"E؉$E܉D$ED$ED$ e[^_]ÍUE 5E t&E"uf]UT$U]T$UE؉T$UT$ dT$ h|$L$T$$ &~D$$e1[^_]Ít&؍xD$dlD$hlT$ <$L$xE؉T$|T$UT$UT$ T$T$T$ āT$$sGvDD$ $1 U卤$ueE1]}B òtcݕ04 $ݝݝ݅݅}EEinf0zBݕ04 *$ݝl݅ut-inffF*jF=zinf*fFj"&؋EUĉD$ $D$D$ GE\$ T$D$@0$xGݕ(, $ݝ݅!DžD+inffDžH*Dv؋EUĉD$ $D$D$ G\$ T$D$c4$4$fjEe3u ]u}]/ &؋EUĉD$ $D$D$ tGD\$ T$D$@<$=0|$D$ D$d'4$D$%[DžD-inffDžH*D븍EE-infE0dt&؍EEnan0G&DžD+nanfDžH*D[nan*fFj'U卤$XeU1҉]E ?Uuu}}  $2t|$4$t$e1Ue3u ]u}]} 'U卤$xeE1]U àuu$4$fUe3u ]u] vU卤$xeE1]U @uu$ F4$Ue3u ]u] Ud$EP1t E$D$U Í&'Ud$EP1t E$D$U Í&'UE@@] Ud$uu}} FtU$T$ׅuV 1t E$D$׋u}]Í&UVd$uFP@N V@BFFt ҉tyF t ҉tWFt ҉t5Ft҉u FP$RF4$d$^]Ít&FP$RfF P$RfFP$Rv&UWVd$u} FtU$T$ׅuCF tU$T$ׅu,FtU$T$ׅuV1t E$D$׍d$^_] Ud$uu]ˠFP@N V@BVFu FP$R4$]u]Í&UVSfd$uFP@N V@BFFt ҉t5F t҉u F P$R4$gd$[^]Í&FP$RfUS ןd$썃D$ED$@$Ed$[]ÍUS×d$썃D$ED$@$d$[]ÍUSWd$썃D$ED$@$d$[]ÍUS`d$썃D$ED$@$d$[]ÍUS מd$썃D$ED$@$Ed$[]ÍUS×d$썃D$ED$@$d$[]ÍUSWd$썃:D$ED$@$d$[]ÍUVS_d$Ћ EED$ED$E D$ D$ނ$t$h1t*Et$D$ED$ D$E@$6d$0[^]ÍUSÇd$E D$E@$@d$[]ÐUSWd$E D$E@$1x$d$[]ÐUS`d$E D$E@$`d$[]ÐUS0d$E@$wd$[]Ð&US÷d$E@@t$d$[]Ð d$[]USwd$E@@ t$@d$[]Ð d$[]US7d$E@@t$d$[]Ð d$[]US@d$E@@@t$d$[]Í d$[]Ð&USçd$E@@$rd$[]ÍvUSwd$E@@ t$@d$[]Ð d$[]UWVES{2d$ED$E܉D$ED$ED$UD$ D$ED$E uEEE$"E䋓 9 9U9UtEtE܅tE؅tE؋MN}~ }܉~FFt9t 1d$L[^_]Åt񍓶o $T$UNjUt9Ft|$T$4$u G<$PF1d$L[^_]Ðd$L[^_]fEt&E t&E1fFt ҉t~떐FP$Rf1uG<$P&US7d$EUM R t]D$ L$$D$Kt 1҃ɉt d$[]Ít&P$R1ҍd$[]Ít&+DЋ0T$$kd$[]Ðt&R_BL$D$$j'USGd$U ҋEt3; t+@t4T$$BT$fd$[]Í&d$[]ÍFD$0$1fUSǗd$E@$d$[]Ð&US×d$ED$E D$E@$d$[]Ív'USWd$E@$7d$[]Ð&USp'd$E D$E@$d$[]ÐUS@d$EU J9Htd$[]ÍvR T$@ $V⍶Ud$ȉ]uÞ҉}ƉBV9twT$$ugGV ҋx FH >t rRFWE‰D$XD$$|$L$ $E]u}]Ë]u}1]ÐE0]u}]Í&'Ud$ȉuƉ]}׋BôV9twT$$#ugGV ҋx FH >t rRFWE‰D$D$$|$L$ $E ]u}]Ë]u}1]ÐUd$ȉ]}W}uEuD$U 4$u/WBt5Rt$T$U $Ћ]u}]Ðt&E]u}]ËGW ҋH >t rRFWE‰D$D$0L$ $ Ud$ȉ]u>}u} E$pu$VBt*R<$T$Ћ]u}]ÐE]u}]ËFV ҋH >t rRFWE‰D$D$0L$ $.1fUd$E]ÎuPJ P ҍ>t rRFWE‰D$L$T$]u]Ðt&Ud$E]w.uPJ P ҍ>t rRFWE‰D$L$x$']u]Ðt&Ud$E]ΒuPJ P ҍ>t rRFWE‰D$L$[$]u]Ðt&Ud$E]nuPJ P ҍ>t rRFWE‰D$L$y$g]u]Ðt&US`d$EP T$ RR T$@@D$$d$[]Ð&Ud$ȉ]uþu}E}D$U <$tE]u}]Í&|$FD$E $]u}]Í'Ud$ȉ]u>}u} E$ptE]u}]Ít&F<$D$A]u}]ÍUd$ȉ]uΐ} S}u $tJxp p~t}lE$E䋓dF H IN1r]u}]ÍUd$ȉ]u>}u }E$ptE]u}]Ít&t$<$4]u}] Ud$E ]u}ȏ@uEE x FD$<$du`GV ҋx FH >t rRFWE‰D$D$$|$L$ $1]u}]Ðt&4$|$dED$D$E $0E|$D$4$ӿ҉tx҉uVE4$REwFV ҋH >t rRFWE‰D$ȄD$$L$ $1-&1WE<$REtuًF4$P1'UVSo&d$u$#tDpp~t}lE$EdF H IN1rd$ [^]Ít&'Ud$ȉuu]}ØFUHy }A~ uBtB@W tc$]uQF@UD$E <$D$ҋ]u}]ÍvT$ @D$E <$D$Uҋ]u}]ÐFHD$LD$$$r]u}1]Ít&'Ud$؉]}þ}uG$ou]u}]ÐG $=t1ƸDѾʍv'Ud$؉]uNu}4$B1U@Ft ҉tfF t ҉tD4$dt~E]u}]É4$h]u}]ÍvF P$RfFP$Rfs봉'Ud$D$$]us}+ƉEtt~E$=F tE]u}]ÍEu؋F4$PEƍt&Ud$]u7u U$Bt pUP]u]Ít&'Ud$]uÞu U$tp]u]ÐUd$]u^u U$tp]u]ÐUd$]ugu U$Trtp]u]ÐUd$]u'މu U$T2tp]u]ÐUd$ȉuu]}Ø}E FHTyBG4$D$D$t$G$]u}]Í&p GW ҋH >t zRGWE‰D$t$L$ D$$$w]u}1]ËGW ҋv H >t zRGWE‰D$t$L$ 릐tpGW ҋH >t rRFWE‰D$xD$$L$ $1vUVSFd$ED$PT$@$w1t!E4$D$E D$҉td$ [^]ÍV4$EREd$ [^]ÐUd$ȉ]uþ}u} E$tE]u}]Ít&|$D$F$]u}]Ít&Ud$E ]u}H@uEE x FD$<$u`GV ҋx FH >t rRFWE‰D$D$$|$L$ $T1]u}]Ðt&D$|$F$ED$D$E $E|$D$4$H҉t}҉uVE4$RElFV ҋH >t rRFWE‰D$ȄD$$L$ $v1&1WE<$REouًF4$P1'Ud$$]uË}U01Uu ]u}]Å@; EE; M M ; t|FueFD D$M ET$D$ L$<$D$9҉eW<$ERE]u}]Í 9u돍t&uAU $PU䍶FD E Pt&uAU $PUt&F D Et&u B$Pt&VD &Ud$EU EE ? Ud$U EE U1U1҉d$EEUWVd$u} F tU$T$ׅu,FtU$T$ׅuV1t E$D$׍d$^_]ÍUd$EP 1t E$D$U Í&'Ud$uu]4F u$]u]É$h1tV9LЉ$L]u]Ív'Ud$]u~u;}ED$ۇD$E D$ D$$Ҫu1]u}]Í&E䍻$|$3E$u,D$$$]u}1]ÍvE$etD$4$gxUUP RED$Ї$3-E|$D$$٫]u}]Ít&Ud$uu]dFxND$F $tn]u]Ë$uu$at(F Fu 1뷍F ҉uP$R1뒉'Ud$]unu4$eF t҉u F P$RF4$]u]É'UVS_d$u4$ F t ҉tWFt ҉t5Ft҉u FP$RF4$d$[^]ÍvFP$RfF P$R뛍v'UVSvd$ЍED$ED$`]D$ D$ED$E uEE$u1d$0[^]Í&4$D$t֋E$Et`$oFFUtfE$F t% $D$D$2F^MF4$1P?FF뚋EP$Rjt&FEFc'Ud$ȉ}}]uA}G wP$RpE8G=$jG>t7$EhƋU8V EF]u}]ÍvN NuFHU܉$QU뫍GwWHthWD$U$tjG>V VEF UV]u}]Ð$tHuf1]u}]Í&F HU܉$QU$,uUtrUB$PFP$RK&F P$R!&UNB1$PTB$P$oG1UVd$uFtF҉tTF tF ҉t+FtF҉u P$Rd$1^]ËP$Rʐt&P$R롍'UVd$uFP@N V@BF4$;F4$d$^]Ð&UWVd$u} FtU$T$ׅu,F tU$T$ׅuV1t E$D$׍d$^_]ÍUbjzUB tB ]Ë ]Ðt&UVd$uFtF҉u P$Rud$^]Ut&UVd$uFP@N V@BF4$F4$d$^]Ð&Ud$؉uu}U} FtT$U$ׅUu} uUu}]u}]Í&'UVd$uFtF҉t\FtF҉t3FtF҉u P$Rud$^]3vP$Rt&P$R뙐t&UVd$uFP@N V@BF4$;F4$d$^]Ð&UWVd$uE} EFtU$T$ׅuLFtU$T$ׅu5FtU$T$ׅuE} uEd$ ^_].d$ ^_]UVd$uFtF҉FtF҉FtF҉F tF ҉t]F$tF$҉t4F(tF(҉u P$Rud$^]|t&P$Rt&P$R또t&P$RlfP$R?fP$Rv'UVd$uFP@N V@BF4$F4$d$^]Ð&UWVd$uE} EFtU$T$ׅFtU$T$ׅuyFtU$T$ׅubF tU$T$ׅuKF$tU$T$ׅu4F(tU$T$ׅuE} uEd$ ^_]t&d$ ^_]Ð&UEU P1]UEU P1]UEU P1]UEU P 1]UEU P 1]UEU P 1]UVd$uFtF҉t\FtF҉t3F$tF$҉u P$Rud$^]3vP$Rt&P$R뙐t&UVd$uFP@N V@BF4$;F4$d$^]Ð&UWVd$uE} EFtU$T$ׅuLFtU$T$ׅu5F$tU$T$ׅuE} uEd$ ^_].d$ ^_]Ud$]u'st҉u P$R]u]ÍUd$ȉ}}]uÈsw ~tQGD$ t$G$D$҉uVE4$RE]u}]ÐGt$1t׋G @ F G @FGGFnt&t$GD$$qtt&US÷rd$EP t+Ht$L$ T$@$D$)d$[]fT$@D$$ d$[]Ív'Ud$t$$=ruVtF$t$]‰F1uv'Ud$؉uu ]}1q}t3G*t$T$$袘]u}]Ðt&Gt*$t$7u4Gt҉u GP$RG1]u}]Ét$G$0yG]t&'Ud$؉uu ]}Qq}tlF@W tBGtG҉t1w]u}]Ít&P$Rܐt&ND$$$n뾍2ݍ&Ud$uu]kpFt&*$T$t]u]ÍvVtAD$0D$$1x‹FF]u]Ít&lD$0$1fUd$؋E ]þou}utS$ ǸtV tF t~ 1]u}]Ðt&B$Pސt&D$$$]u}]ÍUd$؉]EWouPRD9uU@ Ptt.$趛]u]Ít&ۤ$Z]u]Ë@ $腛]u]Ív$҉1t4$c҉uVE4$RE UWVSUnd$ċu ; thEF@W tjE}EԍE܉EАEԉ|$D$ EЉD$4$螥t*ED$ED$E$ay1d$<[^_]f d$<[^_]ÍD$$$1Ő&US×md$싃u)ED$E D$E@ $d$[]Í0D$0D$$>1yǍUS`md$싃u!E D$E@ $d$[]Ðt&|D$0D$$Ƹ1yȍt&UWVSáld$ċ@tF҉FtF҉F$tF$҉t|F$V D$$T$VT$VT$U D$ T$D$VT$ D$<$BtNFFF$1d$<[^_]ÐP$RPfP$RvfP$RMfF$FF몍Ud$eE1]}ck}uG$$D1tVOG;A}iW UP9UtcUND$L$ T$$@҉uVE4$REUe3]u}]Ð }띋Q =~c=LD$ ňUЉD$$UD$踠FUD$ GD$T$ȑ$襭`D$ ˈ벍t&D$ &Ud$eE1]Ul#j}uB$Ủ$1UuUe3/]u}]ÐB$͟1UtNJBM;AJ MčH9MMčWD$T$FL$ D$|$贬҉t1k҉\VẺ4$REHWẺ<$RE뾍&R UwMDMD$ $MȉD$D$U̍GMȉD$BL$D$ FD$<$Cj v'Ud$eE1]UÓh}uB$U$q1UuUe3]u}]ÐB$=1UtNJBM;AJ MčH9MWT$UĉD$FT$ D$$$҉t1k҉\VE4$REHWE<$RE뾍&R Uwt&MI ==YMЉD$ $ňUMD$D$nUMGD$BL$D$ FD$$Q(MЉD$ $ˈUMD$D$MU륍MЉD$ $MD$D$UMva UVSæfd$ED$$tR@@$0F t!ۤ$;Ft d$[^]ftt&1d$[^]ËF4$1Pˍ&USPfd$E@ Puۤ$ʨd$[]Ívt$Ûd$[]Ít&@ $譛d$[]Í&'US×ed$EP ztEd$[]cvB $=d$[]Í&'Ud$؉$]u;e}Ǹttt>1]u}]ËB$P䍶'Ud$EU Ƀ$zv'Ud$EU Ƀ$Zv'Ud$EU Ƀ$:v'UWVSudd$ċUB$M@@WM1At PzTMQ1ɅRJTV@U}EEM܉$荴EMUBVPt@v/DȄҍ@uFL$D$ D$MEL$$艙U$>NjM $Qt t2d$<[^_]Ðt&tV@U PUF4$PÍvUB$rD$FD$ ]t& ht&MA$2UNjBtVPt@/DȄҍ@uFL$D$ M䍃шD$E|$L$$} } }뽍'Ud$ȉuu]}ab~u+Nt Vu]u}]t&$躤FU$UU$EeNjUMVFFG FFGO$U|$[U ɉ ҉tv]u}]Ð1t& $t$EǺNjUFFG FFGct&WE<$REvt&JE$QESt& G & G& G q& GuAU $PU䐍t&B$P1'Ud$؉]u'_uE}D$} F@ $肚¸tV tY~ V 1zt]u}]ÍvFtF҉t/V B F1]u}]Ít&F P$RfP$Rƍ'UWVS^_d$ԋu} ED$|$4$¸FtF҉F$tF$҉tdF$D$<$D$F D$FD$FD$ (D$D$貍t>FF$1d$,[^_]Í&P$R두t&P$RefF$F뻍vUd$ȉ]UG]u}u} T$U|$4$Ut!UE ]}u]]u}]ÍvUd$ȉ]UÎ]u}u} T$U|$4$yUt!(UE ]}u]]u}]ÍvUd$ȉ]}g]} uuG|$EED$4$taE~(FtF҉t!G F}tD1]u}]ÍvP$RG F}u]u}]ËG$۰t݃xFtF҉G FFtF҉GFF tF ҉tsGF F$tF$҉t(GF$G<$P1P$R͋P$RUP$RfkP$Rf}D$$9G<$PUd$]uw.[}u }EEEED$t$<$tFv!1]u}]Ë]u}]ÍED$ D$D$E4$D$ED$D$'tGtG҉EGGtG҉EGE܅MWtGtkE܉G4$D$D$"W u G P$Rw 1P$RPP$RhB$P느t&UWVd$u }Ft$EED$<$¸t2U1t)GtG҉t"}t~*w1d$ ^_]fv wP$RӐt&wԍvUd$ȉ]uGXu}F $迼tQFp D$.4$PE4$裛Et4E|$$mE]u}]Ðt&]u}1]ÐuG<$P1Ɛ&UWVS螾UXd$`$u_$w``$@a$Ӄ b$轃c$觃c$葃d${e$ef$O`g$9@h$# i$ jE؉$j$ނk$Ȃl$貂m$蜂`n$膂@o$p p$Zq$Dq$.r$s$t$`u$ց@v$ w$誁x$蔁x$~y$hz$R{$<`|$&@}$ ~U܉$$$ˀ$赀$蟀$艀`$s@$] $G$1$k$m]D$D$D$ TD$2$˫(`$蓬EE$-ElЉD$T$Uԉ4$yUԋT$UD$$dz<0D$T$Uԉ4$fyUԉD$ET$$z8D$T$Uԉ4$ yUԋT$UD$$y$D$T$Uԉ4$xUԉD$ET$$y"ID$T$Uԉ4$xUԋT$UD$$LybD$T$Uԉ4$NxUԉD$ET$$yf{D$T$Uԉ4$xUԋT$UD$$xpD$T$Uԉ4$wUԉD$ET$$zxpˊD$T$Uԉ4$|wUԋT$UD$$4xLD$T$Uԉ4$6wUԉD$ET$$wD$T$Uԉ4$vUԋT$UD$$w'D$T$Uԉ4$vUԉD$ET$$bw2QD$T$Uԉ4$dvUԋT$UD$$w ~D$T$Uԉ4$vUԉD$ET$$vv |=D$T$Uԉ4$uUԋT$UD$$v LD$T$Uԉ4$uUԉD$ET$$Jv lD$T$Uԉ4$LuUԋT$UD$$v\ 0D$T$Uԉ4$uUԉD$ET$$u ,D$T$Uԉ4$tUԋT$UD$$xu SD$T$Uԉ4$ztUԉD$ET$$2uB D$T$Uԉ4$4tUԋT$UD$$t $D$T$Uԉ4$sUԉD$ET$$t ΌD$T$Uԉ4$sUԋT$UD$$`t( XD$T$Uԉ4$bsUԉD$ET$$t ,D$T$Uԉ4$sUԋT$UD$$sl 4BD$T$Uԉ4$rUԉD$ET$$s qD$T$Uԉ4$rUԋT$UD$$Hs,D$T$Uԉ4$JrUԉD$ET$$sRQD$T$Uԉ4$rUԋT$UD$$rD$T$Uԉ4$qUԉD$ET$$vr$D$T$Uԉ4$xqUԋT$UD$$0r8|?D$T$Uԉ4$2qUԉD$ET$$q]D$T$Uԉ4$pUԋT$UD$$q| vD$T$Uԉ4$pUԉD$ET$$^qD$T$Uԉ4$`pUԋT$UD$$qxD$T$Uԉ4$pUԉD$ET$$pb,ĎD$T$Uԉ4$oUԋT$UD$$pD$T$Uԉ4$oUԉD$ET$$FpD$T$Uԉ4$HoUԋT$UD$$pHx"D$T$Uԉ4$oUԉD$ET$$o09D$T$Uԉ4$nUԋT$UD$$togD$T$Uԉ4$vnUԉD$ET$$.o.WD$T$Uԉ4$0nUԋT$UD$$npD$T$Uԉ4$mUԉD$ET$$nr\D$T$Uԉ4$mUԋT$UD$$\nD$T$Uԉ4$^mUԉD$ET$$nD$T$Uԉ4$mUԋT$UD$$mX֏D$T$Uԉ4$lUԉD$ET$$mUD$$D$G ED$D$$E䋃U҉ $F |$$辉D ED$t$$Ut d$L[^_]ËB$Pd$L[^_]Íh$ʡt&h$財t&h$蚡7t&h$股t&h$j{t&h$Rt&h$:t&h$"at&h$ t&h$t&h$ڠGt&h$ t&h$誠t&h$蒠-t&h$zt&h$bqt&h$Jt&h$2t&h$Wt&h$t&h$t&h$ҟ=t&h$躟t&h$袟t&h$芟#t&h$rt&h$Zgt&h$B t&h$*t&h$Mt&h$t&h$t&h$ʞ3t&h$貞t&h$蚞wt&h$肞t&h$jt&h$R]t&h$:t&h$"t&h$ Ct&h$t&h$ڝt&h$)t&h$誝t&h$蒝mt&h$zt&h$bt&F4$PUDHG<$Pf$뱐H$t&H$t&H$ʜt&H$貜t&H$蚜t&H$肜t&H$j$t&H$R"t&H$: t&H$"t&H$ t&H$t&H$ڛt&H$›t&H$誛t&H$蒛t&H$zt&H$bt&H$Jt&H$2 t&H$ t&H$ t&H$xt&H$Қvt&H$躚7t&H$袚5t&H$芚6t&H$r4t&H$Z2t&H$B0t&H$*.t&H$,t&H$t&H$t&H$ʙt&H$貙t&H$蚙t&H$肙 t&H$j t&H$R t&H$:t&H$"t&H$ t&H$t&H$ژt&H$˜t&H$誘t&H$蒘t&$zUosv$Rt&H$:-t&H$"+t& $ t&\$t&USç;d$܋ED$ED$ED$E D$ ED$D$$xld$$[]É'US萡G;d$܋ED$ED$ED$ED$E D$ ED$D$,$ld$$[]fUS0:d$܋ED$ED$ED$ED$E D$ ED$D$$kd$$[]fUd$]uǠ~:t<@@Wt]u]fD$$T$1$sЍD$$T$$s밍U :d$E@$\UҠ9d$E@$,U袠9d$E@$Ud$؉]u跟n9u}T} Ft1V ҉HN9Oщ1҅ɉu P$R1ҋ]u}Љ]Ð&Ud$؉]u78u}T} FAt+H1҃~IV9щ~-1҃ɉu P$R1ҋ]u}Љ]ÍI̐Urz8d$TE@UBJ8d$žE@U8d$žE@lUd$]u'7tB@@Wt]u]fTD$D$$1$qʍTD$D$$$p뤍v'Ud$E@]'Ud$E@='UWVd$}u Gt-O1҅ɉxI9׉~#1҃ɉu P$R1ҍd$^_]Ð>֐US÷6d$E D$E$蓅d$[]Ít&UWVd$u} Ft1V ҉HN9Oщ1҅ɉu P$R1ҍd$^_]Ðt&USp'6d$E D$E$\d$[]ÐUd$uu}} FtU$T$ׅuV1t E$D$׋u}]Í&UE@@4] UEPt3B$t,BD~%@ @TH@x Rxt]1]ÍUWVS|35d$ԋ@N Uɋ~xG$<M( EMO$O$BtBG F M<$L$@F W tG ɉ ;EttCW$tD$ED$$ȉ1҅t҉t ƒd$[]ÍvP$Rލ'USP'd$E@t$CL$jd$[]Ít&d$[]'Ud$ȉuu]}è&VtKFHjNjF$K$fE<$fnHE$U]u}]Í]u}] Ud$ȉ]u}pa&tMxt?PH~ND$$贁1]u}]Ðt&@ ]u}]Ív؟D$$f]u}1]Í&@tiELK4$׉ƋU$ett4$i\$؆At&'Ud$؉]uG$u}tF,$RRF,]u}]Ít&Ud$ȉuu]}è$NtSFHhsJF$BcE<$dnHEu4 ]u}]Í]u}]&$؅F$l1붐UWVSN$d$EPqUBPoM A@TEEEEUEEȉUċ}E,u̅tM̋E}|$D$E $]EwPUЃ},1Ut&J }ԉ9v;uC<}ԋB ED$D$E $bK1tUtJ|8!d$ [^]ÐD$$wd$ 1[^]Ít&E1뽐t&ۤ$^{먐D$~D$$ U1|'Ud$uu]}衁XNE $VP)~U$T$ UT$T$VJFHF^@FD$ ED$ED$$`iE<$5[NnHɋEu_;Euj ]u}]Ít&U$T$T$ItEEEE\f]u}1]ÐU$zE둋${F$-b1뀐uvD$~D$$tS1Dt&Ud$uu]}FFH]?F$ZщEM܉<$YnHUM܉!ȃ~8tPFx};x}?}}ԃx} tF}t FUD$EM܉$HSM܋Uf$L$4p]u}]Í&N4F8͐t&]u}]&$pzF$`1띉UM܉$KEUMI'Ud$uu]}E~aNHVPu9vD$~D$$Q1]u}]ÍED$>D$E D$ D$$|@u]u}1]ÐFH[E=NjF$XMEԉUЉ $XFHFHU#UЃSUt4B@W'$okEȉUStFH&MЋUԉMĉUȉM̍@FH6[FU$UUE$WFHPVHMFHZEF$2vUd$D$D$]uwt.}$1u]u}]ÐE $P1tߋEUD$ED$<$B‰t"҉uWE<$RE렍1҉uыF4$P1č&'Ud$؉]usn u}4$QD$U4$H=tt$)׍P|$T$cFh $ZKnHFl랍vD$1$f*&:t/F D$$P&:1tMD$ $СlhD$D$di@lF hD$ L$D$Ý$nD$$0JbF4$PTI Ud$$]}p÷  }D$ E uD$|$Ymt+E $l‰t$]u}]Í&]u}1]ÐuF4$P1Đ&Ud$uu]}ao F PBWt~$eǍ>Et <$O0EF$A0NCɉD$ EDщD$t$T$$Kt ҉te]u}]ËF$/NjF $/NCɍt$|$ DщD$T$$vK]u}]ÐW<$ERE]u}]Ít&UVSOnd$uFDt4$V҉F,$95F t҉Ft҉FVHVHEuF$ _uIE$^E$Ud$l[^_]Ðt&D$$Yd$l1[^_]Ë$_F$EE$^1룐뛍D$~D$$-71p&'UWVScÅd$ċuE~NLV tF$+F(~ :ED$D$E $m,EE?UԅE$D$ 4E1"EЍEE̍FH@‹Et$ FUȉD$E)D$E$ ?UȉEȉ$=E9F$F(UuF t$A'F U|fE$D$0‹]u}Љ]ËE܉U؉$&U@E$K[F FHg=@FMD$F L$t$ $;E؉<$9U؃nHt~ ~(V$PF$YUtދ$ZF$@F 1҅$E&F 12)1uvUS^çd$EPt[HLt,1$ tPtKd$[]Ít&1t&D$~D$$11ōd$[]t&҉uP$R1Ud$uu]}A^}UF9tUԉL$$P@U=F0u&E <$T$D$*lj]u}]fN4M؋F8E$U9M }UԅɉMGJ;JCIJMt M tl tMmMMEf$UmOMUE؉F4MN89}D]u}]ÍEE E룍vMEvMJ;JIJIfc1uuJ;JIJ WT$$[0FEE}$U)U}EDE؉E$U(UE$U(Uct&'Ud$ȋE]u}[ÈPRT$T$ED$D$$&ƋF@Tub4$-҉uVE4$RE v$,]u}]Ív$8;ލ4$(;맍G<$PkfĢD$$$FP럍&둍D$$$PuԋF4$P[vD$D$$-0&UWVS.Zd$ċu }F9tT$$<<VF<EuH4$*ML$FD$<$E4$"҉Et^d$<[^_]Ðt&WBWt 9tMԋN@@9V@Uԉ<$EщD$T$Gs룐W<$REd$<[^_]ÍvZ4$D$.CtEG@W |$$F6trD$D$4$Ek#UA1҉A $P1u G<$PF4$Pt&<$U+D$$$M_P<$'BM$PMFM4$PM&GM<$PMvUd$ȉuu ]}WHF9tT$$9tM4$tOFH5‹EU|$$U$_1nH1]u}]Ít&,t;g,u䍃,D$$iL뫋E$i3tD$t$$,҉wWE<$REct&Ud$ȉuu]}qV(1t&F9tT$$8tE ~F]u}]Í&4$ED$#@@1@VuftKE $h3trD$EUD$4$Ud$ċu} (F9tT$$L7FNLV tF$+F(~ :EPBWt>P҉p?D$E$IEtYPBWtPPH ҉?D$E$IE uEd$<[^_]Í| u8R@T$$$M҉EXt&R< u8T$ $rLM҉uUJEԉ$QEnt&EP$R%&vDvD$~D$$l&1t&EP$R&F4$D$=U#;|$$P…]T$UD$4$QEUEfPBT҉PD$$E$GErfD$$G1RET$$eGE&D$~$GF1B$PEF4$PU%$5EUJEԉ$QE1ET$$8jEP$RuɋF4$P1A&Ud$ȋE ]7Qu}u|MtX EF҉$U)|$F,$rF,U|$ T$D$F$u:]u}]ËF1$;)F,$F,1봐&Ud$]uP>u}EEEVt<4$u]u}]Í҉u P$Rt&ED$U܍}T$|$`L$ D$WD$ED$E UԉMЉ$SIUԋMuE؉D$bD$ET$D$E |$L$ $Iu*UEԉ$Eԋ]u}]Í& 1҉D$ED$E؉$ptEU$tF,E܉D$4$J1뉐OU݁Ё]Ív'OU݁`]Ív'USNwd$EP;t$d$[]Í&Pd$[]fUE]@ Ít&Ud$]EGND$DD$E }u}$^"tbEPRTtU$t7@<$D$FD$9҉uVEԉ4$REt&1]u}]Ð4D$$$C]u}1]Í&P<$T$@D$9]u}]Í'Ud$]E7MD$ ED$QD$E u}$J!1EEԍbFuphEЉUċMiMu18t%uqι8u9;MutEĉ ]u}]ÐldUЉM뉍t&uι8tD$$A1fD$MԉL$$1rX붐&Ud$؋E ]u}KhPBW@btAFht,sGi$']u}]Ít&duԍ$']u}]ft#$@]u}1]Íq$']u}]Ðt&B D$0D$$$1WdD$$&@16&USJ7d$E@\$$3d$[]Í&'UWVS>J$TEEЋE EԋduUҿEE$ED$c2كxaE1.EEأ|}؋E 1fEm}m΋EMĉEm؋؃xm}m΋U@}MMM1EE1ƅxƅhƅXMMMM M4>M X4>h4>x4>4>E1M >~$[^_]Ít&t&UBE=1=t$T$EEEU fEЍvEՐt&hvEЍMؐ@9Ȉ4>u1$[^_]Ív‹MMMXExh1E&EE&MMMXhxMM(؍ħD$$<4؍D$$k< #t&'Ud$؉]u}ƋFUHITuItY$t1]u}]Ít&zt@]u}1]Ít& 뭍&'UWVESEòd$D$ED$E $7EUEĉUU3uUfvuDy u-vuEM ME>~1$[^_]ÍvUEU$]EuM؋EvU4UUUF$1[^_]Ít&$uf؍ D$$#SfUBE$R}T$~E1E6t&vE؃ fvGEKfыEEMM|؍D$$%#|UWVSn-%d$ԋǃǃEt&B11&It9tu<Iu萍t& Mtg 1&RH>t@9pu8tR>u덶U}dEd$,[^_]É$@܍Ud$]ub,݃h}]EŤuhǃlEEKפugǃphUԅd]u}]ÍΤuWǃlE녍t&ܤuǃp농ǃp1o&ǃlE+fD$$]u}]Ít&'Ud$ȉuu]}+F9tu|$$) ueF@0@P4$Ѕtk@9t|$$ t:FuF4$]PE؋]u}]F]u}]Í4D$$$]u}]Ðt&]u}]f붐&US*d$E$zU؋E yr]rE}E% fEmm]Eu*z(Pu<&؍d$D[]Ð|؋|d$D[]Í"t$$1뿍&㍶0]1Euv'US(çd$E$Z$d$[]ÍvUS(wd$̋E$*$ED$Eكv ݃pw$Fd$4[]Í&}E fEm$md$4[]Í&'Ud$؉]u'(Et'ЋRPX]u]]$MEtWp9։s@fII9u0B1҉pEމ'US^'d$$d$[]ÍUVS/'d$EP9tt$$H tLE@]E P9tt$$% tAE @UtF}U$d$ [^]ÍUEyEt&UE x1E봍t&z؍ D$ $1릍E 뛍vUd$ȉuu ]}A&}APTuC9tT$$E¸t1f]u}]Ív $t4$ 1]u}]Í $EEz]E؅Ҹu벍&'US`%d$E@$d$[]ÍUS0%d$E9Pt@$\d$[]Ðt&d$[]Í&'US$×d$E@$d$[]ÍUd$]u$^ 9E}EP9tt$$E@]؋E P9tt$$E @UEu%z)$]]u}] ɍvd}E% fEmm]Efiu/z5UE &fE\$E$9݃Ё "f$`1XD$$$^]u}1]Í&U؍EDEt&UЍE EHt&>$]u}]Ðt&"؋8N$jt&݃؁$Jt&؋x}E% fEmm]E]EU]u}JJ׉$T$t&E {؍D$ $1Xt&JH?؍ȩD$$1'UVS öd$EP9tt$$E@]E P9tt$$E @UEzzEuLz uf$d$ [^]ÍE8tv\$$릍UEU>E뢍UE =x9EIP؍D$ $V1a&E R&UVSVd$EP9tt$$t\E@]E P9tt$$tQE @]苃8UEtx}U$rd$ [^]fUEUyEt&UE =yE ʍt&D$0D$$1y뚍t&z؍ D$ $*1qt&'UVS6d$EP9tt$$tDE@]E P9tt$$ut9E @UMU$jd$ [^]fUEMyEt&UE 5x E뼍t&E vUVSÆd$EP9tt$$tDE@]E P9tt$$t9E @UmU$d$ [^]fUEyEt&UE x E뼍t&E vUVSֶd$EP9tt$$8tDE@]E P9tt$$t9E @UEU$ d$ [^]fUEyEt&UE x E뼍t&E vUWVSn%$U e M1ɅҋEtPRT*H@7~ljvvDP uD$4$ݝ?9݅9u"f7DV @u9%$vUe3$L[^_]fPmT$D$ t$@ $1u R!%tDJD)_Љ9 <-Dž<+D$Ǎ2<$D$/ۅ ك$.D$$N1&؉L$ \D$D$4$jt$붍t&릍$T$T$\#t&؉ $؍D$8ك$H6D$ D$<$N?D$D$<$,uJكȁ$oF~Dž<,D$$$ 18D$ fUd$]}7|}E䋃9ljuU MtqL$T$$1t&D$<$tFX҉t]u}]ÍV4$EREԋ]u}]Ít&E$D$L$D$ CD$1tE䋓9Pt $D$$qUVS/d$$݃Ё$NF $oF$4`F݃`$F$@F$1F $"F$$5F(ك$F,$F0$F4ud$[^]Ít 1d$[^]ËF4$1P鍶UWVƍ}S d$UeE1E<$D$ D$ D$UB|$\$ D$d4$-MtzUU ft^DPu҈UtU1MDHue}.t_E@$]VEuw$t1}-inf .G0GUe3u d$|[^_]c vR MԄyʍ&~V.t&nan멍U卤$XeU1҉]EOUuu}}  $R%t|$4$t$u1Ue3u ]u}] 'Ud$UEUU &Ud$EU E UWVSÅ$TeE1hNjuUe3t$[^_]ËXLD$D$$ۤE|$ D‹XD$D$]D$$>uɉpaEtlp1v>tpv9Vutꋅth$t$ZtL$Xt$ D$lD$D$$!>huppbXQD$D$$ Ud$EU EU卤$xeE1]UÐuu$4$VUe3u ]u] vU卤$xeE1]Uy0uu$ F4$Ue3u ]u] vUWVS.d$EeU1҉EċP9tL$$8E@U$]EuU$=EuNuezcs$%vt&؋Eĉ$Ue3d$\[^_]fUȍEUENt&t$ut$UЉET$oE+U$HЍ})։t$ }‹E)dnEEE´ fEmUm‹EEEUE.كmUm‹U  @UEu؋UEҰ+xfEw)UD$T$ ~|$$ &UD$T$ }|$$Eu]UUа-6 UrzE@(D ]Í&'UWVd$u} F tU$T$ׅnFtU$T$ׅSFtU$T$ׅ8FtU$T$ׅFtU$T$ׅF(tU$T$ׅF,tU$T$ׅF0tU$T$ׅF4tU$T$ׅFP,H @(JHx>8u}Ήt&tU$T$U҅uLyߋu}F$t3V 9v,}֍t&tU$T$U҅uv9w$w1t&d$ ^_]UWVd$MA$EA,A$tA,҉A0tA0҉%A4tA4҉A(tA(҉AP,x @(zxx<8M x(vt҉uP$Ry؋MEt?q 9uv7} t&v9v't҉uPv$R9wٍd$ ^_]fPM$RMt&PM$RM1t&PM$RMt&PM$RMt&US` d$EP8@R;B$Hd$[]É'Ud$؉uuE ] Ȥ}~(tHF(F d$ԋ}<$1@8O 9v@} v9v't҉uPv$R9wى}G$t>9s:v9w$v(t҉uvP$R9w$w܍t&G t҉WPW&GtG҉G(tG(҉tG,tG,҉gG0tG0҉ZG4tG4҉wF@t=@txG xtC td$,[^_]Ð<$d$,[^_]Í&F4$P벐t&GP$R&GP$R&P$RwF@2~@S<$EvG P$RE&P$RqfP$R~fP$RfP$Rf UWVSLd$ԉE䍶xcUD D$E$=UtLU ;ptt$$utuF4$Pyd$,[^_]Í&E ;4t˅tU t ҉t E 4맍t&U P$R㍴&M0Pv{vft&'Ud$}}]u1twOɋF$t PBWu]u}]ÍvU܉EȉT$M̍UT$U$EȋM̋PF F,PUЋV(R҉Uu/UЅu(E܉D$ED$E$]u}]fU D$T$ V $M̍8T$UFMtU F(T$ D$UV $8T$Uq9NЋF$EԋE D$ 8D$Eԉ $D$MUWVSÓd$ԉE}vx9EM T t@t+MD$T$ $tyǍd$,[^_]ÐET$$t׍&'Ud$}}]uAtO3wF$PBWu]u}]Í&U܉EȉT$M̍UT$U$EȋM̋PUԋV F,PUЋV(R҉Uu4UЅu-E܉D$ED$E$]u}]Í&D$V $M̍8T$U|FMtF(UD$V $8T$ULz&;UOUԉUԍ8T$Uԉ $D$M'sGt&Ud$]u~u4$FF]u]Ív'Ud$uu];FD~@FD@]DHu]Í&$:FDύ'Ud$uu]$ۚFD~ʮ$FDP@VDU PHUPPUPL]u]Ít&UWVSÅd$ԋE} Ht E9A:|M܉D$E$r‹M@9tU؉t$$U؋M$Mp‹Mw@G@F ɉF$VtN EFGƒtMEEEEFEF Ud$؉]u>}u }¸u'tlF@W tBG w t ҉t1]u}]ÍvP$R]u}1]ÍDD$$$뷍ݍ&Ud$؉]uÎ}u }*¸u/; tptlF@WtBGwt ҉t1]u}]ÍvP$R]u}1]ÍpD$$$뷋G1Ud$$t$&݋u1u FtF$t$]Í& ㍶'UVd$u01u FFd$^]Ð&Ud$$t$Muu+F tF $t$]F u㍴&1$t$]ÍvUd$]u7}u }¸u;tcD9FuXF(1ҋHGtP9urWw1 ɉ t]u}]Í&B$P]u}1]ÍD$$$&]u}]Ít&GUM$菱D$ıD$MUL$T$ $]Ud$D$ D$]EΉD$E u$t$Du]u]ÐE4$D$Qt݋EEUP1fUd$D$ D$]END$E u$!t$ıu]u]ÐE4$D$t݋E$tEEUP1E@@ D$-D$$$D딍&USçd$UERt(tHD$L$$ad$[]fE @܍D$$&1эv'US{2d$E ; D‹UD$ET$$d$[] UWVS.d$U}Bt PBWEEt G@W unEU p$=ỦD$T$ UȉT$UE t$$ D$D$D$ D$B D$B$d$l[^_]Í&<$(E‰$E1ɍE}EuĉEԉt&FUԉD$ EЉt$T$$vMuًUE r}$EŰMT$ UȉT$D$ʋE T$UĉT$Ut$$D$ D$B D$B$UĉE$CEd$l[^_]Í&P $UE_腶1Ud$]u7uF$BD$t$I$]u]Ív'UVSæd$uFP@N V@BF$Ft4$PVV F(t҉VtpFt҉Ft҉F t҉Ft҉u FP$R4$ d$[^]ËFP$RfF P$RK&FP$R!&FP$Rk&FP$R=&F P$RQ&F(P$R&Ud$؉]}G}uu 9GuT; tDF@WtcGt ҉tw1]u}]Ít&GP$Rf1čt&]D$$"뺍v@ D$ D$$׼돐&US7d$E9Pu@d$[]Ðt&]D$$d$1[]ÐUd$؉]}'ނ}uu 9GuT; tDthF@Wt_Gt ҉tw1]u}]ËGP$Rf1ȍt&]D$k$뾍vrD$$ US`d$E9Pu@d$[]Ðt&]D$a$d$1[]ÐUSǁd$E9Pu@(d$[]Ðt&]D$W$2d$1[]ÐUSwd$E9Pu@ d$[]Ðt&]D$M$d$1[]ÐUSp'd$E9Pu@d$[]Ðt&]D$C$d$1[]ÐUWVSՀd$䋃}$@$xE F G4FFF<$ D$<$PBTD FF F(}D$E $FtF(~t}l$5dGVRW:xd$[^_]Ð vt&1d$[^_]Ív $蚦guɋF4$1P렍UWVESbd$ D$(E؉D$$E܉D$ ED$$]d$[]Í&'Ud$ȉuu]}XyF} @Vt WFBVu ]u}]Ít&WML$M $u%ED$ED$B$붍&1u@0|$4$P듍t&US÷xd$E@$7d$[]Ð&USÇxd$E@$d$[]Ð&Ud$؋E]Nxu}tfPBVR0tRRHtK$҅tZPBTuv4$Njtnu(蔳!fGD$$$]u}]fx]u}]Í~uɉ4$RfF4$P뇐t&u4$RzUd$؉]Ew.wu}x"ƍ^D$E |$ D$$4$g]u}1]UWVSvd$ԋǃǃElt&B1E1 I t9tu<I u萍t&} M 1HRRt8@ 9pu8txw܃uҍRRuȉU܋EEDEd$,[^_]É$бٍUWVSõuԽd$čt&9t)vt҉uP$R9uxhNju d$<[^_]ËXbD$D$$ۤE|$ D‹XD$D$qD$$ۡ>~ɉM{lEu1RtPv 9VutND$L$XEt$ D$D$U܉$VRUuEEud$<[^_]ËXQD$D$$1t&UVSOtd$$tIp9Ήs@RR9u4Ad$[^]UWVSÀsd$䍻l(fHpPDvt,ȅu։UUud$1[^_]Íd$[^_]fUd$t$$6ruF=v2t=ЋRlPp$t$]Ë$t$]~‰1uˍ&'USgrd$E $d$[]Ít&'Ud$ȉuu]}q(rF} @Vt WFBVu ]u}]Ít&WML$M ${u E$蒵1u@0|$4$P 뫍US×qd$EM PBVt PA@Vu d$[]f Q$d$[]Í&'US7qd$EM PBVt PA@Vu d$[]f3Q$轴d$[]Í&'US pd$EM PBVt PA@Vu d$[]f#Q$]d$[]Í&'USwpd$E@Љ$%d$[]ÍUSGpd$El9Pt@$d$[]Ðt&d$[]Í&'Ud$U]uM 1oB@VtAqBFVt5I|VtCt> LЉ$q]u]Í& ]u]Ðt&U]u]D$$-1Ud$ȋU]u}8oBu @VtNNBAVtBNtLtHt&V9uJ$貲]u}]Ðt& ]u}]fU]u}]\t&$tbF$tyD$<$e҉t"҉uVE4$RE뇍WE<$RE͍&1bD$$1Au͋G<$P1&t&Ud$؋E]u$m@x؉$茱]u]fu$1tމ4$҉uˋVE4$RE뺍&'Ud$EPx E_ UWVS~5md$ċUB@VJU B@VE @EE;  ‹@@VBEYUԅvEttw9}taɉEt9E̋MЅt}̉ȉ׉}Et똋 d$<[^_]þM̅4$d$<[^_]Ít&U; uMU@0T$U T$U$Pd$<[^_]1ut&Et&@D$$$v1XEỦD$E$ uuMD$$01Ud$ȉuu]}8kF} @Vt WFBVu ]u}]Ít&WML$M $u E$袮1u@0|$4$P뫍Ud$uu]}ØjF} @Vt^GN@VtRWt[D$0D$UԉMЉ$KUԋMy)]u}1]f ]u}]fED$E$uE$赭̍vu@0|$4$P 믍&'Ud$ȋE]u}èiHU AVtvrHFVtjrMEuE}ErjrH؋slI0T$$Q]u}]f ]u}]f؋rfst؉<$薬]u}]ÐUd$؋E]u}èhHU AVt6rHFVt*΋z)1y1y34$;]u}]Í ]u}]fI0T$$Q܍vUd$؋E]u}ahHU AVt6rHFVt*z41y1x44$謫]u}]Í& ]u}]fI0T$$ݍt&US×gd$E$Jd$[]Ít&'UWVUS`gd$} eE1E@UEfʉv)щ1(ѺW M0LUuƃ t6gfffF#)v)ȃ0 w&Uyv-E4$)D$袝Ue3ued$l[^_]Ðt&Fbv0뼍t&}u1Mtv0fFxv0딍t&vR0농Fov0qĥ t&USPfd$ED$D$$:d$[]Ít&'USed$ED$D$$d$[]Ít&'USÇed$ED$D$ $躪d$[]Ít&'UWVSEed$ă}};}$<t)UݤUt&t DP u׊EMu ?0E<$D$ED$(EЋu9tnyNJt]t'DJ uJfDJ tb}l9ljuU MEEsL$T$$@@VtMVUD$<$UtP҉uVEЉ4$REЋ]u}]Ðt&4$uEAUtuF4$P1f]u}1]ÐEL$D$$ED$ D$ D$肟tuE=stlVRTu'D$FD$F $Y*~<$)Eԉ4$>9Eu)ED$D$<$4$uE$e@D$ ED$ȵD$$D$$$1$rt&Ud$ȋE]W`u}HQTu\Q0tiRHtb$҅xGTu~*t&PЋ]u}ʉ]Í&GD$$$.f$ئщfVuUM4$WUM뉐4$蠦щ‹t4UM覚UMXI4$W)FUM4$PMU뵍&'Ud$؋E]Î^u}HQTu\Q0taRHtZ$҅PBTp]u}]ÍGD$$$豹]u}]f$ȾƋ]}u]Í&wu<$Rf<$萾Ƌt&.aWt&<$R=G<$Pύv'US7]d$Et@PRTu(u$萣d$[]Ð$d$[]Ð@d$[]ÍGD$$$褸뽐t&US÷\d$Ex$fd$[]Í&$@d$[]ÐUd$EP 1t E$D$U Í&'Ud$uu}} FtU$T$ׅuV 1t E$D$׋u}]Í&Ud$uu]4[F u$蚟]u]É$h1t+Vxԉ$R]u]Ud$ȉ}}]uÈ[Gu1]u}]f$$tD$D$GU$贯UƋD$G D$4$t҉thwGtG҉G OG ҉9P1$R+t&B$PjVE4$RE뇋$ ̳GtG҉t@G G ҉P$RP$Rv6P$Rf볍&'UVS/Yd$uFP@N V@BFFt ҉t5F t҉u F P$R4$d$[^]Í&FP$RfUVS蟿VYd$uFP@N V@BF Ft҉u F P$R4$id$[^]É'Ud$ȉuu]}!XV 1tF$UD$诞NjUtF]u}]ÍvU$Ut&UޱUt0F 뵍&$Ut&B$Pō'Ud$ȉ]uWX}u }$ tIxp p~t}lE$E䋓dF  IN1r]u}]Í&UVSϽÆWd$u4$u%D$$1d$ [^]Ðt&$Rt@p p~t}lE$GEdF  IN1rd$ [^]ÐUE]@Ðt&UVSE VP~@ T9sf20 @R9r [^]É'UWVd$}wx+G tU$T$U ҅tލd$^_]Íd$1^_]ÍUd$EP 1t E$D$U Í&'U1Vd$uV tN;J}B INd$^]Ít F 1fB$P萍t&Ud$EP 1t E$D$U Í&'Ud$MQA x;P}@ RQÍAu1ÐA ҉uP$R1ÐUVSOUd$uFP@N V@BF Ft҉u F P$R4$d$[^]É'US×Td$싃t%v@$Єuލd$[]Í&US萺GTd$UBR t@;B~1$d$[]Í&USPTd$E@$萫d$[]ÐUS Sd$EP tR+Py$wd$[]É$Hd$[]É'UWVSιÅSd$Ex tIp@ @@x#t҉uP$Ry݉<$0d$1[^_]Í'UVSOSd$ЍED$ED$ۤD$E D$ D$$a{1tdE􍳠@9tt$$-tQEP9tt$$t7ED$ @D$E@D$E@$ed$0[^]Ðt&D$$$1fUd$]ugRƍ@9tT$$腚tF ]u]ÐD$$$覭1׍v'UVSöQd$u F9tT$$t$ED$FD$E@$記d$[^]ÍD$$$&1ڍv'UVS6Qd$uFt ҉t/F t҉u F P$R4$id$[^]ÐFP$RÍv'Ud$uu]ûPFt҉u FP$R4$]u]Ðt&UWV1S輶sPd$ԋ}EG~.E D$D$G $~&Ev9wҋE$ǧd$,[^_]Ít1v'UWV1SLd$ĉE܋E u…EЉU'M4$E܋E EE؃}EtJM؋E܉4$V|Y}D?E9E؉}{uUD$M܋ $D$ɧ}t&d$<[^_]ËM+M M؃}E~sEt=t&ME܋4$|,}L?t2E9M؉}~,uȋMD$D$E܉$+뺐}ԋM;M؋EOME M U+UЍ@ωUu,t&EE$E܉MM̃t;9}=U)΅uƋUD$M̉D$E܉$螦M뻐N9|Đd$<[^_]Ív}ԋE;E؋U OE؋M )+MԉOD$U܉D$$Gft&'UWVS记eJd$ĉE܋E u…EЉU/M4$U܋M+M M؃}EEtAMU܋4$|R}L?E9M؉}uUED$D$$K}d$<[^_]ËE EE؃}EtBU؋U܉4$|C}D?tAE9E؉}~;uM؋UD$T$$虤뱍&}ԋE;E؋M OE)ȋM +MԋU+UЍ@ωUu(UU$U܉MM̃u;9}=E)΅uƋUED$D$M̉$M뻐N9|Đd$<[^_]Ív}ԋM;M؋EOME M Wt&MUD$T$$謣&뺍t&'Ud$ȉuƉ]1úG9V }}HF9ЉUt$ uEFF w-$FFt#~ 1]u}]Ðt&wwF9Et$tUF V빍t&'UWVƍBSIGd$LMJ|M܋LMԋM܋LMLFH9(@FMԋE܉D$D$<$Ux 1)lj}ud$\[^_]Ít&}UUEȋMȋE؃D$$E EEE 19Mjt}܅}EUM@ RAA AE܅ZR1#fPx v9"E܋ D$$DžD9 02R@9rD$D$$]Dž뗅D$0D$$]But&UWVUS{25d$ċ}EGT$EED$D$D$ E܉D$XD$E $kotwuExu9;w|~&uFv9u~f9w~aED$D$G $<~lj4$d$<[^_]Íd$<1[^_]Ðt&GEyE&eD$$d$<1[^_]Ívwu6E1(Ud$]u}Ƌ@39|9}~ |lj9wPu>F 1EMԉUL$$aUt'F V~1]u}]Ð<F ?v$c؍V]u}1]ÁwԉMԹEMԉM{t&Uщd$ȉ]u}x?2t6WM‹Mt F 1]u}]Ít&ظD$$n]u}]Ít&USw2d$U ER1u d$[]Ív'UWVS~52d$ԋE} pU } 9~jbd$,[^_]ÐU E1tߋEx uE1M~&@9IuuEE9E ΍Ed$,[^_]ÐE$EpfUWVS螗U1d$ԋ} uG;t9uV<$D$|Ht d$,[^_]fG<$Pᐍt&;pt<$xE@@pD$E<$tW~89EU$҅F;F}V x;P} @ d$[]Ët>D$$gd$1[]ÐD$$1뷍$:j묍v'Ud$]uw.'u4$%XF t҉u F P$R4$_W]u]Í'Ud$؉uu]&F@Wu$D$" $N1]u]f$it@p p~t}lE$藂EdF  IN1r]u]fUWVSn%&d$ԋE$PEtH|3 jƋU ѷ$D$D$R4$RfEEd$,[^_]Í&iƍwD$E D$$R4$ fURU1B 0׷EU D$T$4$NtNU9z~WUB 4~.i‹ED$E UD$$QU܉$tefF4$PU9zhƍշD$E D$$Q4$0eU$Ed$,[^_]Ðu F4$PE$EEd$,[^_]Í&'UWVS螊U$d$}<$HU1@W t1wx! t҉tZW y߉$_OoG;tl<$ t~^d$[^_]Ðt&G P$R땍&<$ Vd$[^_]Í&G뗍vR닍+p뛐Ud$ȉuu]}聉8#2?@}UE‰$sG UtiT$D$$FVwwt}l$~dGRW:xE]u}]ÐG uG<$Pt&RE]Eu}]G nt&$"eE늍vD$~$|EeUW1VS !d$ԋE UMxz9N19 r9N)U4$1EUt' J x ~1t&@9uEd$,[^_]ÍUWVS~5!d$E} E9Eڷ$T$ZoHPU@@WuyF ExyMA9ljN;UUE;EMNȉM)щMM+MȉMąuKtu F4$PE$d$l[^_]Í&N MyUB1늍t&MI MM  $UMpNjUMEȉEEЉUL$D$<$Qc}OtWUEJUʉM‹MҸEU+M@ L$ED$EЍ$nvE~3Uu}U1ɋu}vtI9Ruu}ċEx7u t&x#t҉uP$Ry݋u1;}tE<$[E҉qV4$EREd$l[^_]ÐE1EvEȉEv&UMBU+ED$D$Eȍ$KuMUĉQsE@ Et&N1)UBD$D$$UkD$ MEL$|$$UWVS.d$}W~a1t&uIv9w~NE D$D$G $Yy~ԍFD$ D$t$<$At5d$1[^_]fD$$.yd$1[^_]Ív d$[^_]ÍUd$ȉ]EgD$lD$E u}E}$1uWtDGUxG9}SO @9‹4tfED$ D$<$PT$e]u}]ÍUylD$1$d$M }uAP0tH@VtBt8 $D$LgtTxit$T$<$yd$l[^_];4t`@ D$D$$$Sd$l[^_]ÉE VUWt$T$<$ 뒍vE؉D$E܉D$ED$ ED$G $D$^E܃t U;U~UU؅D‰$PjE;EM1ủ}ԉM։8t&MTT$)L$$pM9uMvwUԋM̋B UԋJU9rI)뭍&uNMJE܉M2Mԋu A $PFIdMű}ԋEUMԋO9Mu)щO}؅~01 t&9}~ uP$R܍t&4$XT11U;UNL&9{4$D$VfEԋuԅtUԋBU9mD‰$whMԋ }ЋQBWQ ŰM؋u1҉EċEЍv|r )񺉈9t0غD$$nf]u}ȉ]ftfu]u}ȉ]Í&Ud$E]pN u}t PBWu=&D$$dEEEU]u}]ÍpEEEEEx11ɐ|p v}EUMu܋E܉UЉ‰MMԉEUȋEEEeʉEUUElfUSoG d$̋EEt PBWu.&D$$cd$4[]Í&UD$T$ D$U$T$Y=x EUd$4[]É볉'UWVSnåd$ԋu} tyF@WtpF@TF UE~<8ك t&~$@RLF ҉ME &؉ɍd$,[^_]Ð&D$$bd$,[^_]Ðt&qt&d$,[^_] Ud$ȋE]mîuEt PBWu)&D$$#b]u]Ðt&U$T$1M}􈈈P] -ME$)ʉƉT$,zt>"t݃Ёvht&t& t&؍D$$b]u]a]ZBE If݃؁w USlwd$܋E$Ct$? t&؍d$$[]Ðz]A1EuːUWVS^ld$ԋ}G@W|WExM1ȃxQLW 9t䍃8D$$ad$,[^_]Ít&E먐t&x*Ed$,[^_]Í&D$$ `=u}x뇍t&'UVSk6d$ЋEEFHQTQ0teRHt^$҅PBT4$XEUu F4$PEUd$0[^]ÍvGD$$$N`d$0[^]Ít&$Jd$0[^]ÍvUD$T$ D$U$T$8xn4$J‰E;vu4$R;J&D$$f^ Ud$؋M]iÎɉu}tmA@TtYQ1y vxctQ 9t䍃UD$$_]u}]éu)&D$P$]]u}]Ð $hIyt&`UWVSid$ԋuF@Tu#4$Id$,[^_]Í&VExR1ȃxQLV 9t䍃8D$$ ^d$,[^_]Ít&E룐t&x4Ed$,[^_]Í&&D$$\H=u}7vfUd$uu]gëF@Ttvt@]u]Ít&t 4$Tx 4$e̐4$9뿍t&=1u뱐UWVS~g5d$utKF@Tt7Vxk11xDfDV Ruȍd$[^_]éu)&D$u$k[d$[^_]Ðt&4$,荶ڿ댍&Ud$؉]uf~}}FVǍD$LM$|$t$|)]u}]Í&UWVSjf!d$ċ@W1)‰U$GEU1xTEU1u1| D }؉E1E؍T1҉uUfD IE)9}uЉUfEԋp1)~.UԍAf|B u } Pf|W uЅxUԉBEԍd$<[^_]Ð9tyt&UWVSne%d$ĉU‰E@r1)ƍF$Ftw111~,ufu|V }ff|P R;Uuۉf|P x1)օ~*Vf|P tt&Jf|H uʅxPd$<[^_]Í&9tyt&UWVSdSd$ԋp@1M)9O)ЉUE$EP@ D$T$$*9}}Eԋ}ԃ E}ЍpЋJ uĉMEUċE}|x }ԉM9MsVE}ȋU1ɃU̍tx 1&}GUEd$\[^_]ÍsD$$>1d$\[^_]ÍvEE E E E~&RŰEM EŨډEȈM11EUuԍ&MЋuTN uԍ &9}„t<UĹ0!vUԺW} LUԈ}M̋U9U|Å„uăEM9MЉuu-E EEE u*uԋ} t&ȍRljtuԉUMԋE$(EMU E MẺuЋM̃ME̋u11UčD 1EȍEčT1҉uԋUfD IE);}uЉuEf|p EũuE uEfщ} We(0 LЃmыUЃ tFfuNj}̅u֋MA $PFxv0&U̅Ut&Fbv0&D$$;d$\1[^_]ËM3MUt^Uu:EP$R1vEu$}^v0S11Fov06B$P뗋uvUSEçd$ED$ D$D$$d$[]ÍvUSEgd$ED$ D$D$$rd$[]ÍvUSpE'd$ED$ D$D$ $2d$[]ÍvUS0Ed$ED$ D$D$ $d$[]ÍvU1ɉWVSDãd$ԋ} u u}t!&UEIU ‰Eu $Ms%Mt&H tP ff R ud$,[^_]Ðt&UWVS^Dd$ċM ɋU1 ЉUMEt&U1MԋEUfv uUЋMԉỦMȉ4$$ŰMt4߃}Ep t p vff>ύv ud$<[^_]Ðt&EUىMg UW1VS|C3d$ut;u<$($txtP fff Rud$[^_]ÉɐUS Cd$Ex$ d$[]Í&$ d$[]ÐUWVSBÕd$ԋ}xdEtd1t&vu4$x#t.MڅEptP ff Rud$,[^_]Ðt&E뜉}1뤍US@Bd$E $0d$[]Ít&'Ud$ȉ]u}HBøITu} t9B@TuO|tO1]u}]Át@U$j0UB@Tt]u}]ÐP$R]u}1]ÍB$0|UVS/Ad$EU D$E$EEEu" &؍d$P[^]ÍED$E$V ]ED$E$A Ezt$ɍ{t&v]ȾEUU1PE+E=E=xww]]ME})$ƉT$*Ezt>"tx݃Ёwn݃؁wh$v13EP]ȉ$RE?EP]ȉ$RE$x ؍$D$$41E؍D$ $41US>çd$̍EU D$E$Eu d$4[]ÐUEUu6 ɉ tGM҉u͋UJE$QEd$4[]Ít&MI3JyXU ɉ uUJE$QE륐&US0>d$̍EU D$E$EtAEPxGUJM҉tnM҉t@d$4[]Ð d$4[]ËUJxftPtډP뫍&UJE$QEd$4[]Í&UJE$QE{;b;똉'US0=d$̍EU D$E$EtAEHxGUJM҉tNM҉t`d$4[]Ð d$4[]ËMQxn‰M҉u&UJ$EQME҉uUJE$QEd$4[]Í&CZʍ?P4ډP*&'Ud$؉uu ]};è}PRTu't 1]u}]Ð@$u*‰Ҹtڋ1э&Ud$$]up;'4*u]u1]fD$E$ ҉ttX]u]Ðt&VE4$REٍ&UWVS:õd$UM 9‹uEEsUԉt$L$$NjUtrp$1)Ɖt$t2WP~1ҐLW fLP R9u҉td$L[^_]Ë҉uW<$EREԍd$L[^_]Íd$L1[^_]ÍEt$D$ $ED$@D$ D$tËUE=sJITu#tXD$BD$B $M1zщ$q 9uCED$D$E$DD$$$.1E$6@D$ ED$ػD$$^ F4$P1$ $'u'UWVES8Âd$U D$E$Eu d$L[^_]Ðt&E$e 4 U)kȉEЋBR1‰U)EԋM}M̉ $BEPt1t&fDG @9uE1҅~@Dw }1׍UMTr v щff@;uu։}ȋuЅw1)~0Qf|W t#t&Bf|G um…WM҉tTM҉UJEĉ$QEčd$L[^_]Í&EfTG mv_9u랋UJEĉ$QE똍t&S t1vD$$N,1U&BUWVS6Sd$UMEPAq1)Ɖu1);UnO}}E1҉}Lx fEEE̋EUủEMGY}̋GW1)‰U+UЉUȃ$E4UȅMȋ}1LH EME)UMDQ f9M̍WULQ E1҉uԉEЋUELP ŰEE|zUщ})ljE9v8EЋUԃ)։މu@֋}uU9ΉErE}9}}wu11 u9u~`M|A @}ЉɉM)ʋM|q }̉ffLw +U9EM9M~uDN fDN …u:}Efm1U9U} M}tO m}t&UEЃf}~M9M}1ɋU1ủMt&U;U}M|A M@|V ff|V 9EMȃmhu}w1)~9Af|G u.}Pf|W ЅUBE$UEŰMu A $PMv}MWA1t }_EPtMA}@}EM M 11d$|[^_]Í&M̍GEuTA EvYuu F4$P1E11F7؉F-UR;}4$|$NjS$ MD$ $k҉VM҉0}EUB$PMfEEQ $EEE$usUMuDQ f;DV $EtUEƃ9zlؐt&`uM̋uud$|[^_]Ë1҉F4$P1B$P+QE $REVE4$REF4$PDMu }G<$PEAU $PU<}tj-D$ $%%1UF4$PUB$PG<$P닋G<$PoUS0/d$܍EU D$E$Eu d$$[]ÐEU$ED$7xSUtUt)Ed$$[]Ðt&EP$RUu׋EP$RE뤍&UVSo.&d$EU D$E$E4u d$ [^]Ðt&EUD$E$Ep$!tfED$D$4$"ED$D$4$"UtZUqEP$Rd$ [^]fUtZUuEP$R랍EP$RfUt*U1넍t&EP$RfEP$Rȍv'US-÷d$܍EU D$E$Eu d$$[]ÐEUD$E$xSUtUt)Ed$$[]Ðt&EP$RUu׋EP$RE뤍&US@,d$܍EU D$E$Et&D$0D$$xCEU$ED$"x&UtPUt2Ed$$[]ËUEu! d$$[]ËEP$RfEP$RUuԍt&UWVS<+d$EԋP;EԃfEUz}fE^T|&"Mԋ}IM؋}E}9}M}؉}E$ M1~f}!|&u !ʋMfTA @;Et=19E~}LG f3M19E~}TG f3U҃^u1ʋMfTA @;EuË}ċUԋMw1)~*Af|G tt&Pf|W u}Ѕx{GỦuwd$L[^_]Íf}]f}RfufuE|}ԋE}؋@Ev} fTG 9ty끍t&<$҉rW<$EREȍd$L[^_]ÐA $PfB$Pff}fufuEUԋMf}RU؋IMUf}U&9UNM܉MEf9EEfuEf}pUEfUEbt&Eܾ&E|$EtlfE!UԋtHMt1,A $P1v$XEfE1B$P뭋MUS'gd$̍EU D$E$Euu d$4[]ÐE|$EM҉t'M҉uɋUJE$QEd$4[]ËUJE$QEōt&US'd$̍EU D$E$Eu d$4[]ÐE^$E}M҉t'M҉uɋUJE$QEd$4[]ËUJE$QEōt&USp&'d$̍EU D$E$E5u d$4[]ÐE&$EM҉t'M҉uɋUJE$QEd$4[]ËUJE$QEōt&UWVES%Âd$U D$E$EExE$jo< U)NjBR1‰U)E)}ЋuЅE)))MĉM̸MfEf5fE‹EЉ$EH~}1ҐM|H Mf#}f|V R;Ut)EEMDH Mf#E fDV E뼍t&~1)~ Qf|V t:M҉tJM҉t\d$L[^_]ÍvBf|F …sVM҉uUJ$EQME҉uUJE$QEd$L[^_]Ðt& d$L[^_]Í$@tkE4$D$NjtG<$ƃ҉G<$Pt&^Ewt&tO19 $MƋ҉ttM҉t6&D$$~1g&EP$Rit&F4$PfEP$R{&UWVS"Ed$M ɋE}uTUܿE2EEU1:UMu0U :: u@9EwM)9Ήus E<u}争$1҅ME}11E}uĉE t&uuu}t4uƉ%}I ƒvu}ԉЍIf%fDw uEE9EwɋEt}fTx }UuڅDUUPUu1)օ~+Vf|P tvJf|H ufʅMxaPd$\[^_]ËuTEܿEh2Er$dd$\[^_]9uڐt&떍&'US` d$܋EEEED$ D$D$$d$$[]ÍUS ǹd$܋EEEED$ D$D$$Ed$$[]ÍUWVSud$E$]E:$] ELEw?$ED$M9$# ؍d$L[^_]Í&E붐t&I]4 )΍F$1EtM三$)‰))L$xDt&}Eִ fEmUm֋EfDw EE$D$y ؍&E̅t_d$L[^_]Ív؍xD$$1t&؍D$$1'UWVSõd$u~1)lj<$t"VPxt&T~ fTx ud$[^_]Ðt&USWd$E$D$r$d$[]É'Ud$؉]uWu}4$"u<$Ɖ]u}]Í$Xu1]}u]Ív 9Ft 4$Ƌ]}u]Í&뎍vUSgd$E9Pt$d$[]Ãd$[]ÍUd$uu]dVu 9Vt!4$AtVډP]u]Ívt&'Ud$EHxEFzv'UWVESÒ$4U D$E$EuEv\ D1DF@TPE@KPDž<t9PBUDž<EPD$ EP@U܉H@DžT@DH L&TT t$4$E u܋PEtCHPD$$tguELYE4$D$Ew8u܋PEHT$P$"tguE-; URUuEP$Rt& $[^_]ÐPF@D$$$1ExuUUPtPRE܅p҉aE܋P$RP&T1Dv t#t҉uPv$R u݋U䋽TJEP$RU>EP$R-D$$^ F4$PNfF4$Pf8F4$fP@EvqF14$PcA $PfF$P2fF4$PfE؍`TU܉\LωHkvu܋P7EtALPL$$t t]EE;TU$T$qƉEtty҉gP$RYF4$P또t&LPfx $EP$RHqDžPaU܉T$P$UEEEwEHPH|U܉LHDH DžT @1t$4$HEu܋PEt?LPD$$Dlt teuEsT@uRTTIHEfF4$PTfF4$P됐t&>\4$D$NEu܋PEaLPD$$Fnt-uEUUu EP$RU M@0t$T$ $PMP $fEkPtGMEPYADž<EP$RbF4$PvB$Pf묃<~P4$T$EHt5}EF4$PEP$R_F4$fP뾐Ud$ȉT$]uS ƋE}D$׉4$VPtaM Ht 1҉t)]u}]ÍB$P1҉u׋G<$P]u}1]fPtQ҉t(xUM H1F ]u}]Í&QE $REǍ&F뺋tU t d$ċ}w 4$t)9w t4҉uP$Rw 4$]uؐd$<[^_]Í&w}xE1ɉEԍ&VtEԋ}@ }I9Mv }ًEԍd$<[^_]Í'UWVS~ 5d$ċ}w 4$t)9w t4҉uP$Rw 4$uؐd$<[^_]Í&W}xE1Eԍ&JtJEԋ}@ }v9uR }֋Eԍd$<[^_]Ív'UWVS ud$Ex <$t{~K1J v9~3U$Uu݋t31d$L[^_]Ðt&M9y t(uB$P|B$P‰u׋FVExEE}Đt&Btuċ}Jv <O GEEE9E܍R }ˋ}[vUWVSed$ԋu$tFV VU׃zt2WP WPWGVn  d$,[^_]Ð ~~9}{EvUIt&Q@ 9׹|уxtE׍I냐t&҉u P$RD$X$R1qvE닍t&'UWVSUd$ԋUJBɉMuMV ;Q UrxNMUIMz92vLu`Vu RE܍LvI u?R9׉}EvpuE@d$,1[^_]ÍE܋MVQ8H ҉tOH҉uHQE؉ $RE؋UjMvJRH Pd$,[^_]Ít&H QE؉ $RE띍t&D$$F 1$u뤋F4$vP &U1WVSód$ԋ}wtLG ;F uwWF9‰E#x RNfu:R9UI }tG1d$,[^_]fF4$Pᐍt&oRWd$,[^_]fD$$G 1먍t&'UWVS.d$ԋE@EU1~UB U;B UrxHEPH9։U/vUE$|$ Eԉ$!MD$ $UԋXEԋP$RG&d$l1[^_]Ðt&MQE $REJ1Mċ҉uMċQE $REs҉dWE<$REPvpB$jEtUċB E܉D$E$)MċUA Ukg$%ERUċJR LD$M܍E܉$MċU܋AI TE܅׷$EMĉ$L$hU ɉ MQE $RE&UWVSÕd$ċE} $UEtE|3vsD$c<$D$G4$EE؍d$<[^_]Ít&3D$pB<$D$4$UB׷E1EMԉUt&UEE M9JE܋MUQrE܅tӃHM~2UEЉMȉD$D$<$jMȉ $UD$|$B$HMD$L$<$EỦ$D$|$4$蟸 F4$PfƉ<$gD$D$跻4$/E$E؍d$<[^_]Ëu F4$PU$E5t&u F4$PE$Et&UWVS~5d$Ex$%1M@qYvFt ҉t.~:v Ft҉uҋFP$Rčt&FP$RƋEpE9t4$O]MA;뗍t&'Ud$]uþ_uF9tT$$$t(Ft]u]Í&CF卶dD$2$1ōUd$؉]u>_}$?E$F |$T$$ʅuv D$oD$F$觅uS D$YD$F$脅u0u G<$P4$4]u}]Ðt&tt"1]u}]ÐG<$Pؐt&F4$1PӐUEt]ÐUd$Et ҉tÐt&P$RÐt&UE]Ð&Ud$Eu}PBUu1u}]Ívt| ፶pz}1)}rT7뵍v'UE]Ðt&USG]d$E;PtZ;|tb; tZHQ0t R(t$҉¸Nd$[]ÐQ8tuڋQ4t u͍d$[]Ít&d$1[] USç\d$E$|d$[]UWVd$E u8GQ9tSR0tRDtE 4$D$҅~&G@0t@DtU t$$Ѕ~d$^_]Í&BTu1US@[UJ[]Í&'UWVS[d$ԋt7&HIMH$EЋu؍d$,[^_] USW[d$썃{$'d$[]Ð&USp'[d$썃$d$[]Ð&US@Zd$썃$d$[]Ð&Ud$؉]uþZ}u赨tR$T$?tt&$蒰UUFD$ B D$2UWVSKd$u E~PGTu=bG D$D$$$1d$L[^_]ÍW$U؉t$NjUtHAUEEVME ɉM<U؉t$ $Ut҉M҉uWQE؉ $REFfEoaUMBT$D$<$ы҉҉V4$ERE؍d$L[^_]Ðt&4$UD$D$1U$Uu1U뀍t&EɉuHU؉$QU؍vM,GFD$ B D$d$UtB;tH@d$[]Í&q$D$薎t ɉuʋB$P{1 US@=d$E D$E$3t7҉td$[]ÍP$Rd$[]Ð1Ѝ&UVSϣÆ=d$E$E]ȉD$sEuRzPE݃݃}E fEm]mEtdd$@[^]Ðt&$ED$}Eك fEEmUmUUEm]mMȃud$@[^]Ít&$]MlEtwNك$oƸT4$҉=VEȉ4$RE)كUd$؉]ug<wuF]u]Ðt&vED$ED$E$D$D$$豇x%ED$ED$E$迁널t&Et҉u EP$REt҉u EP$REu]u]Ít&҉uEP$R&D$D$$xt6&Ud$ȉ]uì:}EUP9B(}W9t r(99t9r(u|$ $q]u}]Ít&ED$E$vh¸|tȐEPR(t uNI(9tw҉t^UuŋEP$RfU $T$n&|$ $R(X $|$jDEP$R딉t$$ыUƋu UB$PM҉u UB$PUd$ȉ]u}b9@;B9rs]u}]ÉU4$ ۤUuFx $UۤUuBH L$<$UU| u5F;Bs-v]u}]Í 9t9v]u}]Ít&Ud$؉]u臞>8@}}B B d;U G;Bt0EU $H; j ]u}]Ð;t@T u:@(tU <$T$1t}uJ|뤋PdtME L$D$<$; u҉^GtP봐҉ U o~t}u(U |Q}wM␍t&U G;Bt̓}tǍD$0D$$ły1M@3&P$Rf$1P$RvUd$؉uMu ]!59Uut0u ]u]Ét$T$ $|Ƹtۋ9Ft*4$g҉uVE4$RE묍1;PэvUWVS莛E5d$ċu }-%19,@B B d;G;FPPT NAT Id}1 Etv@dtoE $6; :$EfUCvt)U䋌BPT uG@T tڋPduf}vW~ …ҸI‹@j d$<[^_]ÍHd uԋMԉ}䋔~뢍&P(t$<$҉‹9GtoH¸Il&[ B$Pt&BM$PMt&fD$X$蒍$誌¸&'Ud$؉]uÞ2uFP,u.t$@ D$$uƉ]u]Í&4$҅tHQTuUűA D$D$$$kuF4$1P듍1]u]D$D$$芆҉t,tˋHƋQTw$zt0VE4$REÍv'Ud$ȉuu]}街X1tsV;(O0;D$$豑D$t$$cDžWBWt(]u}]Í$svD$D$<$.X҉uWE<$REfD$4$kt8D$$EmbUNjVB$PHv裉F@Wt"FD$F $8]u}]Ív;t8@DtA4$Љt&]u}]Í14$萓$V0tV`Ud$ȉuu]}x/F;;(xD@B B d;qF4$PD‹h tDB@Tu8@ D$hD$$U$jhUtFt&1]u}]Í&D$肈ux]u}]ËB1$P볐$Zq렍4$8뎍Ud$؉]E臔>.u$5Tt @@Wu]u]fD$D$4$҉tːV4$ERE뷐t&Ud$]uþ-} }Ɖ~3D$$i]u}]Í&ˀt]u}]Ðt&<$XuF@tLU|$T$4$Ѕu<$1t$踎<$ubE4$bƅ]E $D$҉uVE4$REovp‰t$UD$ D$<$D$ZYU$l2f4$ mCpD$<$D$Y4$lfUd$MEU ME Ud$uu]}!+XD$D$$Xv‹UD$D$4$ UU$YVҍtB D$ D$t$L$D$$;X]u}]ÍD$XD$$X]u}]ÐUS@*d$E$Zd$[]Ít&'Ud$؉uu]}} õ*FVǍD$wtxp]u}]fZUd$]u觐^*uF$Bwtp]u]ÍvZ'US`*d$EtUPU Pd$[]Ðt&[ZUS )d$EtU Pd$[]Ív#ZUd$؋E]׏Î)u} J;4k8Nj 1)ρJɉB)JB A HkB4FBVV;V VFtd;Pv_NAFNHNɉ;Qw ;PvN@FuqFtp t&$xd]u}]ÍvF~VPFtVP@F@$1dDf<FFtp<뉐B*H BJ P QgF<}<N*U1d$uu]}ߍÖ'xAuA~w6?9ItlQЋ2qt3]u}]ÍD4$w]u}]ÐA;A4Aqf<qFAAAuA<t@FF pp 9~tR~ F )V ~VA qF pt&FV@AUM@$vMUuH@A@ǃ<+8qim۶FFAƃDAAA@E@utA?+EAE?EA <AAp4fEum8UL$$SEU+8Mċ49ȉEsYI}M @1y;Es>kM;Es@k}܍ M9I$ kq}kMEM4@kEEE1EEEE ۉUE䉃fUd$ȉuu]}q($E tk+Q;4sk8:)ׁvN4$D$.RE]u}]f$pƋ]}u]Í&tQ<9w 9wlj$Ypt%t$|$$Ef4${Uw1]}u]Í&4$D$|QƋ]}u]ÐUE]@Ðt&US0"d$܋EH PL$HT$щL$ @D$$$rd$$[]ÍUd$؉]u׈Î"u}|9Ft'-D$%$ }1]u}]f $WtߋV~N P@HP ]u}]Í&'Ud$]u7!u|9Ft"-D$$l|1]u]Í $Vt@VP V PVP]u]ÍvUSw!d$UB+B$$ed$[]Ðt&U1S莇E!d$UJ;J}BIB J$dd$[]fUSP!d$E Ux;B}B B$dd$[]ÍD$$|d$1[]Ðt&Ud$]EÞ uD$}Cu EEE$0[u1]u}]Ðt&4$xE܉4$D$ED$ ED$D$ZtM܅U}9~G~CB1)px{|$%UqUpPU܉P ]u}]Ð9}yG)1p1뱍t&E4$D$D$Zcf,D$$.{1& D$${1&US`d$EPu3H t[L$ HiщT$L$$bd$[]Ít&H u͋@T$ЉD$X$ad$[]Í@D$L$a뮐Ud$؉T$]u賄jƋE}D$׉4$VtPtp;`t@t1ҋ]u}Љ]Ít&G<$P1ҋ]u}Љ]ÍxMF uB$P1멍t&FxU1҃F 둍UVSäd$D$BD$4$Vt+PtG`9t=Hn t d$[^]ÐB$Pd$[^]1ɍd$[^]Ít&UWVS^d$Up9H,`ED&xt;Mu"R@9}MR1d$[^_]Ðt&ERE8d$[^_]Í'UE]@ Ðt&USwd$ L$RT$$P¸tR1t 1;`d$[]Ít&UWV}ud$EfE4$tE@tU$T$U ҅tҍd$ ^_]fUWVd$}EG\t d$^_]Ðt&w EEiMrEEE5M[1i4?1ƋEU$Oui 8#6D‰G\d$^_]É'Ud$EP1t E$D$U Í&'Ud$uu]DFt҉u FP$R4$7K]u]Ðt&US÷d$싃dt%v@d$Jduދ`tǃ`҉t/htǃh҉u P$Rd$[]ËP$RƐt&UVS]d$9BuOB tGD$T$4$VtHPtf`9t\Hn  ɉ t*d$ [^]f$U]hUud$ [^]ËB$Pd$ [^]fd$ 1[^]Í&'UWVSUd$ċ}u 9}F;t ;EF ;G GuԍUUЍ}UЋEԉ<$t=Ult_tۋ|d$<[^_]Ð}ԍE}EfG u֋Pd$<[^_]ËUԋHTtӍt&d$<1[^_]Ðt&4$H`EtE؉EuKUԉ$`Ct4$ftME؋UЉu҉uVẺ4$RE멐UԋB$Pu F4$PUԋ:B$P1B$Pt&UVS}Ôd$9Bu7B t/D$T$4$Vt0P1t 1;`d$ [^]Ð$UeUud$ [^]Ð&UWVS^}d$E@E܋uMʋE܋v!u؍<Ћw ;u ;`}tE9MCEuTE!Ћu܍<Ƌw;u uF`9u uE}}u܍TE!Ѝ<Ƌw9u tuEE9Eu;`tE ỦMD$D$4$qEԋŰMtREԅx\E@EċE9Euf;wuJEԅhfd$L[^_]Ðt&UE}d$L[^_]Ít&F4$PMЋU1ËEĉEԋuԋEu܉EuĉuE ỦMD$D$4$qEŰMt-}xE@EԋE9Eu;wu}cfCF4$PMЋUv'UWVS>{d$EU MUM܋PUԋHM؋M䋓9Qt"PU܉M UEd$L[^_]}܋U!M؍4ыF9E;`ut9>EM܍TE!ЋM؍4F|9E|`M5M;Nu MEuuM؍TE!Ѝ4Ft89Etu}$wEuE]u}]Ðt&D$$V1tWMyUD$ $0cNjUMT$|$ AUD$$RVUEtQt6iZG<$PE]u}]ÍF4$P뿐t&B$Pk U\&UWVS^xd$ԋE@ URUrt5`9t1}ֹwUj uV d$,[^_]Ð`EURɉU~9} &ET&A9ER|zt9tI녍OD$X$m1yt&'UWVSnw%d$ԋE@EU1ttUMB ;A MQMqA9,`DM䍴&xt;Mu:R@9}ERPUtaM1Ad$,[^_]Ít&ERhPGd$,[^_]ÍPD$$*lE@ 1믍t&B$P딐t&USpv'd$썃tD$$$kd$[]Í&UVS/vd$ u$RtVpV @P V pP~t}lE$kEdF  IN1rd$ [^]É'USuWd$EPtH ;J t1$Rd$[]f@$Rd$[]ÍUd$ȉ]uGuu}4$94$1stk$r‹tNBD$F@ UD$m$QUNj4$n]u}]Ð1t&|NF@ D$e$~QNj]u}]Ðt&GU<$PUc믍&1]u}]Í&B$Pjv'UWVSt d$}u E<$8EtN|@Q‹G@ UD$ D$e4$D$v:U$MEEԍd$L[^_]cQ‹G@ UD$ D$t4$D$*:U$MUۤUȉ}ЍUljU̍׷Uč&E̋Uȉ$EtcPE<$t$2U$DMED$t$@$J6}t}Љ<$mEEԍd$L[^_]Ðt&}P‰t$ yUD$D$$ZU$L<$lUWVS~r5 d$Ex$%=1M@q`t $ZUr 3~(vFt҉uFP$R؋MqE9t4$GdOaMA;t[;tSM $ t~Bd$[^_]ÐM $=d$[^_]Ít&UB뭋ERd뤍vW뷐Ud$]uGq uF9tT$$dStu]u]&|D$4 $Re]u1]Í&'Ud$ȉ]up~ u}F9t9tT$$RtCEU $1tEUH E]u}]Í&|$F$Ru|D$& $d뼐&Ud$ȉ]upþ u}F9t9tT$$Rt;EU $[1tEPE]u}]Í|$F$Qu|D$ $cUd$؉]uWo u}} F9tT$$nQt]}u]t&|D$ $Zc]u}]Ud$ȉ]unÎu}U F9t 9tUL$$PUt]}u]&|$F$PUuЍ|D$$b]u}]Ív'Ud$؉]u'nu}F9t9tT$$7PtF ]u}]Ív|$F$Puڍ|D$$b&UWVSmQ$T@RVGW F V G WFVGFWEFM9EDʉMON9WMONMONMO;Ftt;WtoD$F$JOuF\G\$[^_]Ít&GL$$OtɋF\W\V\G\$[^_]Í&NdMHMMHMMH MMHMMHMMHMMHMMċH MMȋH$MM̋H(MMЋH,|MԋH0xM؋H4tM܋H8pMHu]}u]kv|D$ $*[]u}]UщWVSfcd$EċB9t$9tMT$$HM9MtsA tluĉ‹}V4RWT9A1xFv4qFt*;`t"V$EĉMAM;y~1d$l[^_]ft$A$HMa<9A $GGth4$x*E‹EUűEP$R뾍UB ME,Md$l[^_]ÍvVuFP$R!p:ut&UuEP$Rf $ME^CMYuĉ‹}V4RWT9E؍U܉E}uUUЉMU E؋UEЋEEԋE9EUD$E|$ t$T$$gbu)F4$P F4$PuF MM}؍E܉}u}EZt&UWVScu d$} W~11 t&v9w~ T Eud$ 1[^_]Ít& d$ [^_]Í&'Ud$؉]}Gc } uuG9tJ;tBT$$VEu2D$G$=Eu ]u}]Ív1tރ]u}]Ít&Ud$ȉ]}b^ `uɉd;t ;@duF~E1}FF EFFF\U܉4$^U܅ҍF`Ft :t}E]u}]Ðt&UD$<$ƋUt;@FFF\u땍WU܉$1>`UE늍&uF4$PEc&UWVS>a d$ċu E}F;t;t$T$ACt]G UUЍUU;F 0EԋUЉ$pUuы|d$<[^_]Í&D$F$ButI<$=EtM؉Mt&Eԉ$ t~<$HDt)E؋UЉ}ttUЋEuMԋŰG<$PEBUԋ}0#vM̋A $PEB$PEt&G<$PB$P]A $Pf;B$Pfst&'UWVd$M uA~y~M1 9y~?T M0Mt9҉u֋V4$EMRME9yd$ ^_]Ðt&t1d$ ^_]Ðd$ ^_]|F4$1P Ud$؉]}YÞ }E uD$<$1tt ]u}]ÐF4$Pސt&Ud$؉]uwY. u }}F9tJ;tBT$$;u2D$F$m;u ]u}]Ív1t߉Nt3 t]u}]Ðt&P$Rސt&F4$Pt&Ud$ȉ]uXN u}U F9t;tU|$$:UttB9t;tU|$$~:Ut]}u]t&L$B$K:Uu͋ ]u}]ÍD$F$:Ul&'cXk Ud$U 3X; Ud$U Ud$ȉ]uGW }u} t ]u}]ÐG9t#T$$79u1]}u]f$$ ,tI1ҋtMM4$L$CMƉM[A $PMt&Ud$ȉ]}WV } EuXt]u}]fG9tT$$O8tҍv$$H+tI1ҋ*tM*MEL$$XMƉ MgA $PYv'USU7 d$E D$E$1t$bd$[]ÍvUd$ȉ]}7U } Eut! ]u}]ÍvG9t#T$$7u1]u}]Ít&$$*tG1ҋtMMEMƉMu A $P>1w|$$1]XD$E$.E҉4P$R1&Ud$]uSÞ u;Et]u]1D$$.(u؋]u]Ð&Ud$]uS> }uE9ED$ D$D$F D$E $tu9tUr]u}]Ðt&Ut"9rt\Mt׋P uЋ҉tOhtP붋ED$$K'^]u}1]Ít&E{t&P$R1҉hT뗍t&UWVd$E} $EtHO~!1T ;Ut Etv9wEd$ ^_]Í&UtEEd$ ^_]ËB$PE뼍Ud$؉]UQÎ u}B9} t;tt$$3G9tO;tGt$$3u7D$G$3u ]u}]ÍU$t9}tՉsuɋt-1뺍&UD$B$83R눋F4$1P넉'Ud$؉]uP~ u}} F9tT$$2t]}u]t&|D$> $D]u}]UWVSNP d$EMP9ЉEEqEBEBEB EBEBEBEBEċB EȋB$E̋B(EЋB,EԋB0E؋B4E܋B8EB d$ЋD$E $$t^ED$ED$ED$ ED$Et$$x8ED$ ED$ED$$t'd$0[^]Ít&Ctd$01[^]Í'Ud$؉]u=^ u} F9EF9PBV$MxoF 9PBVu#VRBWu]u}]Ðt&$hUx9E |ӋME ;~ɋU1:u뽍t&E ڐE 느PBTt$UBfMU 1 H‹UMt&VRBW(TUM2IE b'Ud$ȉ]UW< 4u}U}u $3 Ut-D D D Pxp ]u}]Ív'US;× d$̋ED$EEE$+u1d$4[]ÍED$ED$ED$D$E D$ D$$tEt‹EMT$L$$+%딋UEUfUd$ȉ]E; u}$b,tlE $Q,D$D$4$$҉tH҉t ]u}]ËW<$ERE]u}]Ít&]u}1]ÐVE4$RE맍&u͋F4$P1듐UWVd$̉E+E E} E U E؉UUE 1DuԈEẺf  uM8 D@Ru܉}̋uME1eE uU uM8Lt=u }uЍ@9E}͋EEȍd$4^_]Í&ME~>}4:u9UԉEЋU؋Mċ}t&F:vuI9UԋEЉMċM9Mt4u }kẼ9E3aUuE؃E9E9sJ%v9v9Bu$d$,[^_]ÍvUURPt$dd$,[^_]ÍvUWVS>, d$ԋUzrt=t"<>9sJv9v9DBu$d$,[^_]fU`URDPt$d$,[^_]ÍvUWVS+e d$ԋ}Gwt~te19ƉEs>1fuHv9uvAuu!1ҍv9uw<$Od$,[^_]Íu$0d$,[^_]WDP$ fUWVS*å d$ԋUzrt=t"<>9sJEv9v9DBu$d$,[^_]fUURDPt$d$,[^_]ÍvUWVS^* d$ԋUzrt=t"<>9sJv9v9DB u$#d$,[^_]fUURDP t$d$,[^_]ÍvUWVS)Å d$}GwtutY<19s;#1t&v9vQu(uЍv9w$ud$[^_]Ít&$\d$[^_]ÍvWDP$5׍t&'UWVS) d$}GwtutY<19s;c1t&v9vQu(uЍv 9w$d$[^_]Ít&$d$[^_]ÍvWP $sՉ'Ud$]u}Ƌ@MEԋB6( @T} tzBEBE9}}ԅHU)99M||)9L)9|m}t9]u}]Ðt&taE|$ D$L$T$4$v]u}]Ðp}^9U}]u}1]ÐMԺHHE$D$MЍED$' ‹MЅҸuE'UWVEUS&ï d$ED$D$D$ E܉D$kD$E }ET$$tRU܋B@Wt|J~K1&uTU܍v9r~1ET D$E$D$u1d$<[^_]Ð|d$<[^_]ÍPd$<[^_]ËED$D$E$t$롍t&'UWVEUS%Ï d$ED$D$D$ E܉D$kD$E }ET$$tRU܋B@Wt|r~K1&uTU܍v9r~1ET D$E$D$u1d$<[^_]Ð|d$<[^_]ÍPd$<[^_]ËED$D$E$t$롍t&'Ud$uu]}$h F} @WG@W9}FW9‰щUOȅ~5VUWUU+UUu19ɍv(ʅɉMu;EE| ҉U}wU ]u}]fUm}t"P]u}]Ít&N;Ot@|]u}]f}M&uuF:Guv9u1҃}‰Un&1҃}‰UV&1҃}‰U> Ud$4$|$u} N;Ot14$|$]Í&F:Guv9Ӑt&UWVƍES"p d$ MЉM̉D$MEЋ}D$ EEED$$aD$jME9E9EPRTtxPUĉUPU܅}؋EԅN}9N0)҉tZET$UD$$ʍtDžI/t&TUԉ|$T$ U؉T$D$4$vd$l[^_]Ðt&U؉$T$)Md$l[^_]f@E15fM؋EԉM}N}9N+Eҍt>utk)x'Efmxu}u9uENt&@ȹHUԉ$T$a`1t&V}9|<9Nt@T$$]u}]Ív]u}])׉D$0$~tT8-u PD80뮀+t UW1VSQ d$ăUHEt~~-MM t&9~ D>DB uEߋUMҸu8}tt 9VtmE)D$D>$d$<[^_]ÍvE߉MM؉u &uu9|^MT1DP u݋M9Mu| UWVƍESP d$D$EUE|$$jEW; KPRTV1Uȃ}PŰ@EE5Mȅ~8uЉ 9}~UЉt$D:D$Ẻ$5uمuEËUԋMȅҸ}tt9V)D>L$$hd$L[^_]Í&1d$L[^_]Ðt&t@4$tڋUԋET$D$4$ ҉uVE4$RE몍`D$$|$$Od$L1[^_]Ít&UԉNd$L[^_]Ðt&EËMȉuЉ}ԉt&~9}"UĉT$UD:D$Ẻ$uԉ9Mȋ}ԋuUd$U EJtUɺ'Ud$U EJtU~ɺm'Ud$U EJt U1A18&UWVSÅ d$U B@TM RUԉUQUMEҋIEЉMU$E̋Uu)#umuЋ}u9uuMЉ $Uĉt$M̉A E AUċME)ЉD$D$ỦBYt9M̋EftQE UD$$E̋E̍d$\[^_]Í|mD$$EE̍d$\[^_]ÍvM E $D$ED$WEuEUEM̉A AEAE̍d$\[^_]ËŰB$P*t&USç d$싓9PtP@T$$d$[]Ðd$[]Í&'Ud$uu ]}H F@TVUNMEɋ@EUȉM$NjUȋME$UԉL$ED$‹MD$EЉUȉM̉$G wUȋM̋EыU)ȉD$D $G7t+1tqEt$$ lj]u}]Ð|mD$1$]u}]Ðt&UW GG룍vE4$D$ED$1 uMUG<$1Pi'UWVSå d$ԋuF$ED$tdU@vMt$T$$uM~>1Mf|1DxtU܉MMD1U܍v;uuЍd$,[^_]Í'UWVS> d$ԋuF$ED$tdU@MvT$t$$}M~>i1Mf|1DxtU܉M7MD1U܍v;uuЍd$,[^_]Í'UWVSE d$} wE؍ED$ E؉D$mD$E E$JBUJE;  PRTPU܋@EjEE̋E܋M̃}  LU$0EUx8E̅1ɉMĈU&U:T7yMĉƅu1ɋ9G!zUЉJ$yJMЋuJUЋB$PE't&UD$T$<$QEЋEЍd$|[^_]fEEЍd$|[^_]EU JL$(Et+UuEօx2EPU~%U BM̉EĉUM8L7yUȍT$<$8t2} MЋUԋA 4UЋEԃB$x"MЋA $PE)D$D7$E} 5MЋUċI EE+Eą&MԋEЉL$$$EԋɉuH$Q뤋EEEMTE:TȋMăT7D$$L$豺ME)ȉD$D$} MЋA MԉuȃE+uB1ɍvMt$<$ƋMv UЋB 4INMÉD$EЉM$MuˋFM4$PMfMЉD$ $F4$PU$T$U܉T$.&EU Ũ} L‰$aE}vuEt&MHM T1DP uy dfx]T9DP txM)D9t$M$FƋMtg} UЋB Uԉ4EE+Eԅf9uu9AuUЋB EUЋMԉJ$NUЋMЋA $PEt&D$EЉM$MHUFM4$PMA|mD$$EdUԋB$PUбB 8υ vD7DB uvt$<$} 2UЋMԋB 4EuF4$PgEЉt$$uF4$P뭉֋QF4$PC^F4$PPuE MD$EЉU$MUuB$PF4$Pt&UWVSÕ d$u ~E؍ED$ E؉D$rmD$E E$蚻BMJE; PRTPU܋@EEEEE܋U}  LˆM$EMUEE1҉}MUEM:L} :L@9Eԅu MЅW;}UȋMЉJEȍd$l[^_]Í&pUD$T$4$aEȋEȍd$l[^_]fEEȍd$l[^_]EU JL$xEtMEEEȉu9|QUҍru~DuuU}VUЍQUU}ċu8T7SEE9E}}9}uċM+}|$D$V} :}ȋUG 4uȋEFEȍd$l[^_]EE9F}ȋG 0E~fM)щ}M̉‹Mċ}̉U|$D$EԋUy} <}ȋMЋ RE9UUE+EЅU&}ԋEȉU|$$UMԋuAU $PU둋uD:DüUMD7}ԋuЉ|$t$$蜲MUiMċUE+ED$}D$ο}  UȋMB 4MM̋ŨEU }U+}ԉ|$D$rt3} Mȋ}ЋA 4Eu G<$Puȋ}ȋG<$PE&MȉD$ $IF4$PU$T$U܉T$EU Uă} L‰$!EX}<1҉E׉uԍt&9~'M 0MU f9~ D:DF u9Jw9~4MM}̋Uԉ&v9~ D2DG t}9uuEԋ9PUԉ)MD$D:$ƽNjMJ} !UȋB UЉx L$$]u}]fD$$$&1Ӎv'Ud$ȉ]Ew. $}ur=t)u.Ut]u}]ÐuG$ƉxWFF FT$UFT$$t,uEu$ Uuit&uE$u䉳ID$1$'&胱t&UWVS> d$ċuEۤEԋE v|$u܉$6$ZE}MVRT1U1ɁeuGu؋V r~TtKRuօEօ҉9@9EыUuu؋T r~TuuEt$$>ǃ҉u-F4$P t&u F4$P<$d$<[^_]ÍvD$u؋$k9d$<1[^_]Ðu؉|$$}Etˋ}U؋EE19fB H@L$4$UЉM̉D$nM̋U;}|9}~5B@WuD fE܉4$D$EԉD$/u9}Uˉ֋҉EF4$PE&VBWtGF H;t ;(҉VEЉ4$REt&F 빋F4$P1R D$D$$T$ $螷~1v'Ud$vUd$]U'} u9‰}M uEt$UԉL$$1ƋUtMH$L$MNjMt&@IVL$T$$F GG t]u}]Ðt&F4$P]u}]ÍEt$D$ $` D$ D$1tEt $ܲ딍ۤ$躿낍&'US÷| d$܋E$芿1tEU$$Ed$$[]fUd$ȋU]}uh| 2} F@WtTxP>uKFuDGUD$4$UtkxD8@ 1]u}]Ívu F4$PD$$x]u}]É4$.)뚍v'Ud$ȉ]u}Ƌ@}){ 9}W+NF UȉMED$F$1ɋUx>NEDEDFF = F |$T$ $f>]u}]Ív'UWVS,z $4\U E.@d+D$$辱1҅EPUPEdDEF҉UrEԍEUȍMЉ`TPEUMLHXLH`L$ D$T$XTP $Ъ/UȍEpE)Љ$p8ZEU9tM)ˆGM@uM4$hL$M؉lL$E؃xD$\$^U܍Mdtflt$dhL$d}܅}f4$6E؉4$D$߾S҉넍t&tNUE)ЉD$E$Rx0Uv$[^_]f%D$$NEt ҉t1ҍ$[^_]Ít&EP$R1ҍ$[^_]Ít&V4$E U$D$\`d-@WUUDE 1tB)ȋV;;l;;/D$ $tD$4$&$<誫<CAQ$pt&@=u~#M1f@9DŽuꋕDž.1t 9t DžIyӋuU9Bta+Eԉ|$$rU܉$T$UT$yEEEUԋu EԋP$RE;1&Љ@=uvUWVS~5i d$ċuF$ED$*Ets$kEE~avu趨1UhM1v;uUt2M܋<1xut UcɐM1v;uu΋E؍d$<[^_]ÍUWVSuh d$uF$ED$jEN$M衏UDž~yv‹DputM}}~OM#t&U訿}D7v;uUt"Mċ|1DxuЋMD1v;uuދE܍d$L[^_]ÍvU(UyUd$M ]u}xg AuP0tM@VtGt= $D$ٳtZxf|$4$]u}]Ðt&;4tX@ D$$D$$$w1]u}]蓢v~4$|$1땍&E؉D$E܉D$ED$ ED$F $D$襪U؅Mtk}tp4$͍NjE؉$0M؋U~1f  @MU9L$4$8Eԉ4$荓E t&}u;Vt7DT$$1ۤD$$9~u$&US×e d$܋EPBWt@d$$[]Í&U$T$UT$蒽¸DEd$$[]ÍUWVS~5e d$ċEXU v 1d$<[^_]Ët&B@0$PTEt̉<$GM?<$-U‹M)E Mu}o}xts}Xtmt&E9E}X8E0EM܉d$<[^_]fB$PDENB@0$PXE3RE4M)M܅x-pUȉE܉D$$EԋUAM1҉M~%}̉ϐt&  @9uUԋ}̍4LU+U~10@9u U~}1}v@9u}؍ }XuЋ}E܅}1}܍&JwR@9u}&1D$e$耽d$<[^_]Ðt&PUD}.mEG<$PHf\G<$1PN'UWVSUb d$u }U$UDƉẺD$8E$uUE9uEȍEԉMčnjEM)&utxUMԍRM;U<\u׍B;E[R yv9w)ЋM$L$D$ŸEM$UD$L$UNjWGD$EԉT$U$:UUԋG<$uPU;UvE+E9E~D$E$>Ed$\[^_]ffB$PiUA1d$\[^_]Ír9uv UU:yEzMu}Ĺ u} M?MVE EB9UЍHv3}u EUۍA:T7uNjUuƋ}9҉umEE]E뜍t&8I' U卤$h]Et+P D$E܉D$ ED$nD$E u}uE$6tzEPRTu1tAUD$T$ U܉T$4$]u}]fPU؋PUЋPRT뻍t&UЉ$T$U؉T$˜t]u}1]ÐE܋PRTPUUԋx}̋MEЋU؃EĉUtjFtcEą%FEtF}>EċUL$ MD$$~ʉL$vt6UD$ET$ D$4$N\Uąd벍Ủ$T$UԉT$蜗Mԋ}̉M9}~}EčVL$ UMUD$$EʉL$A+EĉE‰E}9EEMD$$ԄE1}MEUMU}tuuGM)t$T$ $UʐUu֋EU4$D$T$謐uuumEy}U)T$M|$ $<9{EUMD$T$ $FEuE뚋FE9NEωʉ9EML$$躃E1}EMVL$Uĉ|$$̏EL8EQUEE+WU1ҍI}u׉΋M9FEU4$D$T$su9}ՋuMEEtEuċE+ED$UEĉ$D$8E!nD$$薧1}`UFT$EUEĉD$$EUMEME$D$Mx1UGT$UT$$蓎EUĉT$tE4$D$vUM}učTωUHEU)Mĉ$T$L$t+MčL$MUL$$UU֍}UFuUċUETΉU9~*@UM)‰L$T$$uڅuE$)D$ZE1}|u}MQUE)ʉ $T$D$UM蟦mNjUMl‰L$)ʉ4$T$U4UOփ}UM)=uu+uMEt$L$$EEVuEEUEDΉE E;u~,@U$)‰T$UT$u؃}uOMMMʉ}9EDE9D$$E1};uGfE+MUL$4$MD$"M|$΋M4$L$ UUmUą~SUEM+ML$T$$M‹Mt19EuU4$|$T$4>豋E묉uM+MEL$D$4$舋EqE EċM‰U)$L$E1}U5EMҍtuRU6t&)|$t$ $UMU}ċuׅ~FmuU)ET$$Mt$tMut$|$ $贊Eu)UE~UċUT$D$<$ME躣EM\E$D$M~1;UFT$|$$4E)UĈTUDM|*$)‰MT$UT$=MtUĈ@IωMT$UT$4$ɉE'UWVS螬UF $EU e M1Ʌtu:D$*$贠1Me3 $|[^_]Í@@WtH$QdT$|$D$ mNjB@W.Dž(DžBp8~@Wt9fT$$輍:f'XDž'(&^<%uɋ(z(< Dž1xv b*   ƒDžDPЃ0vDPgfffꋅ)9 7DBt1gfff4)9  L2y .% Džc l6h)L%Dž Dž Dž%1Dž Dž9M);}k+TdЉ$|$$螝+$xt5 t 19)‰tX6x)9~uul1 @)9|牕++  <$T$D$)91v@ 9v~t %/  }B$Pc($8‹tT%SRv$!g)ƍ|D$t$L$ L$$yv$U 1TBDž( t' B BGB Iƒ~DžҋDff^VNFvB@W$Zd ‹@@W@W  @9Љ|HЉl$賡 ?@듋B@Wg, B@WD$D$$茑ƅ-DžDž idE$AtyB@Th @ @T  u $Wt&B@ D$ D$D$$$uFfE$, 苍IfGtgu+ wW fۤEЋD$D$T$ Uݝ$D$D$gq݅T$ \$ D$x$-z ! t݉€DЋ@D҃+ Dž ҃0 <+t<-B1҃ t&W IƸ&(Ѕv))uٍ@ߍt&v*gDž Ay DžDm0vDP@gfffꋅ)9* FL7Ћ8Dzgfff4)9 yfD$$6Dž\t LXt x6 B BGB fЉ$D$n "t҉ T$$m g Dž(DžDžv($Nl@@V$g}z v3t&#t&$P$R D$ Yݝr݅4؋B@ D$$D$$$oB$P1vDžg݃ 5whDžf &Dž+҃Ѓ t&B$Pt&9(tu G<$P+D$$$茐$Dž \Fqd$|$$K0)$Ac~P$R؃r($s‹@@V$zqDžHvB $Us$mLt&, $yۤt1udXqQ6ۤtXxT$D$T$D$ U$D$D$@Nhw8؉T$ D$ D$x$g !%tމD‹RD )‰҉Dž 0;(D$$$Œ T ?A $P1D$ D$T$ D$T$$kl 0 ҉2  $u$P$R t u A $P@`D$$$聋tD$$$bP$RDžDž؍HD$$ eB$P9jB$@ D$D$$AhDžBT$T$D$T$ U$D$D$@d4(t?A@Wp(bq)Ɖ4$辇x"(D D Ru䉍+$GD$$$JD$ D$B+D$ $c<$D$Ƌf$t$$W$҉u$J$Q҉uV4$R҉Q $Rы҉u $P(-(G<$PxouۤpkD$$҇DžB$PDž@Dž%'US×+ d$EPBWu d$[]ÐU $T$id$[]ÐUE]@Ðt&U1҉WVS|3+ d$ԋ}E uIЋG9ƉUO9L)Љ$DŽEUuvL RH @9Ed$,[^_]UWVS* d$ċuR$D$F$E~$qE[$VD$FUԉ$~$pUԉE؉$#EEU11~}fL L L @9u9}~F+E؍։fD MD$B@x0UԉD$ $P9}vUω֋EU܉T$D$ FD$$yM܋҉tDM҉td$<[^_]Ðt&QEԉ $REԍd$<[^_]Íd$<1[^_]Ðt&QEԉ $RE뫋U܋uыB$P1랍US`) d$E Ux;B}L D d$[]Ít&D$$覄d$1[]Ðt&Ud$M ]u}è( AuP0te@Vt_tUUԉD$ $uNjUF9D D ]u}]Ðt&;4t0D$$$1]u}]Í&E؉D$E܉D$ED$ ED$F $D$kxQE؅R$~gcUu0FHt&D$$\1qt&1e$0TU؋}F1ҋL L R}9U)t&UVSo&' d$EPD$T$$ƸtE 4$D$҉t d$ [^]Ðt&V4$EREd$ [^]É'UVSæ& d$EPD$T$$BƋE D$4$҉uVE4$REd$ [^] UVS6& d$EPD$T$$ƋE D$4$f҉uVE4$REd$ [^] UVS% d$EPD$T$$bƋED$E D$4$l҉uVE4$REd$ [^]Ð&Ud$؉]E藋N% uPT$D$$Ƹt4$s҉t]u]ÍV4$ERE]u]Í&UWVS$ $EeU1҉@BD$D$$Mdx <$heD$ |$Bt$$gO(@UDžDž(t&9BBx<D$$C$k$J<$g‹$gD9|$$k<$wg<=<$D$k$Hg<,G F4$P1Ue3$\[^_]ÍuˋB$P1f...t?1tED)@$d_F4$1P붍t&뫐B$P밋B$PF4$P1bafUWVSå! d$ԋuR$D$F$%u$g~=1 t&9~-T t ɉ uT JE$QE9Ӊ4$yd$,[^_]ÍvUWVS^! d$E PEE11 9ȍvNjuu܃})%}1} M=fffQ WQXuA Qv d$\[^_]f$qEtӋU1~{E E 11ҋxu؉}<E}}؋4;7t5}ԍI<}ĉ7GEG G}Et8}ĉwRE;UuUMQx $K/uU B $`ct%D$<$@$D$dFM܉ $*ct%D$<$R$D$.FuЉ4$bD$<$[$D$EzF4$Pd$\[^_]Ë}%1} UB GBXB BEE=fF4$P[fF4$PfUd$؉]}跄n }u<$St#@$D$$q$dF]u}]fUd$]EW D$ED$$D$ D$ED$E u}EE$\u1]u}]Í$D$E$ktЋUEt RBW MP@$D$Ủ$p$cMƍR$D$$p$cMEԍ[$D$$p$c;uԉEЋU9;U<EỦ$nƋU 11~3t&R T @9tUJAWuT f9}~[+EЉuЍ5&MQx2$T$ptUЍvD 9}~Euˋ ܍v֋U_EP$RNv9MT$t$ A D$D$$$\UUE1P$R&T$UMԉL$ B D$룋UB D$DD$$$T둉T$Ut$ B D$p`UE]@Ðt&UWVd$}wx#D tU$T$U ҅td$^_]Íd$1^_]Í&'Ud$EP 1t E$D$U Í&'U1Vd$uV tN;J}D INd$^]Ët F 1fB$P荶'UVS菀F d$uFP@N V@BF Ft҉u F P$R4$YJd$[^]É'UW1V1S d$ԍE܍`Et&M܋U 12AzABt"}t&p $Iu}vLud$,[^_]Í&USG d$싃t҉uP$Rǃxd$[]ÍvU1S> d$UJ tA+B${pd$[]ÍUS÷ d$Ep@B$;pd$[]ÍUWV1S~s d$ԋ}EG~,E D$D$D $s~ Ev9wԋE$od$,[^_]t1fUWV1SL~ d$}t&v9w~(D$D D$E $stٍd$[^_]Íd$1[^_]Ðt&UWVUS}â d$ċ}EGT$EED$D$D$ E܉D$XD$E $QtouExm9};w|v&u>v9u~^9w~YED$D$D $r~ɉ4$nd$<[^_]Íd$<1[^_]Ðt&GEyE&D$$vrd$<1[^_]Ívwu>E10t&US|g d$E Ux;B}L D d$[]Ít&D$$qd$1[]Ðt&UVSO| d$EU uHAWtR8uM;P|L t t t 1d$[^]ÍvA $Pd$1[^]Ðt&tu F4$P=D$v$pd$[^]Ðt&tu F4$PpD$$paUSP{ d$EU HAWt>x;P} D d$[]fD$$pd$1[]Ðt&=D$e$Bo1뵍USzÇ d$EPBWt@d$[]Í&=D$Z$nՍvUd$؉uu]tz+ F@Wu$=D$$n1]u]f8$Wt@p p~t}lE$oEdF  IN1r]u]fUWVSyÅ d$ԋ}U G@WtlB@WtcGEBE~eM1Zt^v9u~V9u~QD$D D$D $UnU}ʍd$,1[^_]Í& d$,[^_]1t&;u}[;u}V}t@}t*ED$D D$D $Yd$,[^_]ÍP릐t&|떐t&}lUE9Eu|1U9UE9E1U9ŰE9E1U9U뱐t&Us5WVSIx d$ԋ}OxF CBxV4t&1Ɖx4JXBUM$k`UMu͍d$,[^_]Ít&|Dd$,[^_]Í&'UWVSwe d$ԋ}[UƍD$E D$$,>4$1Q׷EGE D$D$D $:uAvW9~G~T‹ED$E UD$$=U$,Qfd$,[^_]fUTUƃt0D$E D$$i=4$Pd$,1[^_]ÍSD$E D$$9=BT먍UWVSnv% d$ԋEU@$EA1@EUƍ| 5&x t҉uP$Rf}~:UBU$t~kd$,[^_]fE䁼`UB;puU䋄UB E䃄`떍E$Ad$,[^_]Ít&[뎉'UVS?u d$u t&~A98?d$ [^]Ëd$ [^]Í&tA `1ҐD R9uq~t}lE$jEdF  IN1rd$ [^]=Lpt$$6_12u`r=D$ $eh1Ud$M ]u}sØ AuP0tM@VtGt= $D$YtZxf|$4$]u}]Ðt&;4tX@ D$D$$$F1]u}]Hv~4$|$q땍&E؉D$E܉D$ED$ ED$F $D$PxqU؅~q}u#}u;Vup9Nu nv$8f[M؋}M1ҋL L R}9U0t&1$$eUWV1S\r d$ԋUE }IB9O9Lu"9up9Jud$,[^_]Ðt&)U<$eUtޅt ~1f L R9ud$,[^_]Í&'USqw d$EPD$T$$3D$r$[d$[]Ív'Ud$E]gq uM ut#PBWtuM E]u]v=D$y$ze]u1]ÍUWVSpõ d$ԋuE EHEENƒt(u$}9Et8:d$,[^_]fp9~tt$ d֐Ѝv<$t&ctM~x 1ɉEV1~&T @9FI;MuԋEyt&UWVSp d$u }F@Wt|FGy':d$[^_]Í$`ctO~1ҍvL L RO9V| ~1ҍL  R9Vd$[^_]Ðt&@ D$D$$$B1i&Ud$]uGo p9E}U MEtuL$T$$1u ]u}]Ë~E|$$t܅~1ҍvL L R9u҉uVEԉ4$REfE$D$L$)D$ UD$F1pEt $\\$aKUd$uu]}An VtCUȉ4$2NjUtN~g$J]u}]Ð]u}1]Ð $J]u}]Ðt&$UEaEԋUt@ẺU&UԉD 9}~sB B d;~ẺMȉ$`Mu"D Mȉ$jMȉEh Eu1Mԋ҉ Eȉ4$>gEUЍUȉ$IEtMԋA ED$E$c\MԋEA }Ut^D$VIEUkMԍzT D$UE$ \UԋED M:׷$ IE!Mԉ$L$WM҉UJEȉ$QEQEȉ $REt&UWVSkõ d$ԋE0p9F'NɉM M 9MkE:FH@VV@BFE 9E~U| uMfv9~2t҉uߋvPM܉$RM9΋uM 4$L$20M 9MEw8~t}l$`dFWRV2pd$,1[^_]Ã>&Mt\=D$)$^d$,[^_]Ët=E $]M…҉t1d$,[^_]Í&F4$P뙐t&F4$P븐t&ʋM+UD$T$D $M7ENE4$3넍UWV} Sir d$u4$%]t~1ҍv L R9ud$[^_]ÐUWVSni% d$ԋUBTtUt@O~91ύ&B @; tU$\@Uv9ڋUBTU%BTd$,[^_]UWV1Shã d$ԋ|E䍻D7v 0t57DŽBtB҉uƋP$R뻍vǃ|$?Ed$,[^_]É'UWVSLh d$ԋPT|P|u_1E䋻 t&E|0v 0t{U2BBt׋ɉűBP$R뾍BE~W}1&v9u~d$,[^_]Ë}OTōvUE]É'Ud$D$E$ÍvUWVd$UHPҋq~W401 9~Iv~uF uMNtɉu͋HU$QU9&d$ ^_]Ð&UWVS^f d$EpV`9t1V`9uFtU2V`9t1tE$ҍd$[^_]Í&'UVSEU eÐ @Uu9tH1;[^]Ðt>q~19Q u9T t@91[^]Ðt&[^]Í&9uf9t䋀uUWVSLe d$ԉUHTt^BE~TB PzTy>1@Vu#4f9}~3UD PRTy@VtD$4$%GuыNTNTd$,[^_]Ít&Ud$ȉ]u}Ƌdc }~VHuxt9ti]u}]f~h}txhu9tY}tu 9tKv9uƋ]}u]Ív;xt߉]u}]Ít&FUEU랍FUEU뮍&'UWVd$u} tU$T$ׅuftU$T$ׅuLtU$T$ׅu2tU$T$ׅu1t E$D$׍d$^_]É'Ud$Utǂ҉u P$R1Ív'UE]@T%Ud$EP$Ð&USbw d$Up~B@,$DЍd$[]Í'UEP@] U9йtu1ɉ]ftH;JuH;Ju䋈;u֋Hh;Jhu΋JT3HT뿍'b U]Í&Ud$ED$E D$E$UUSaw d$ED$E D$E$U1x d$[]Í&'UMU A+Bu 9w B]Ð]É'UVd$uFP@N V@BF Ft ҉tYFt ҉t7Ft҉u FP$RF4$d$^]ÍFP$RfF P$R뙍v'UWVd$u} F tU$T$ׅu,FtU$T$ׅuV1t E$D$׍d$^_]ÍUS0` d$UB@htD d$[]f0D$0$vU1ٍv'US_Ç d$싋p9Ht*PD$$0U1d$[]Í&H9t捃D$$L$ T$$2d$1[]ÐUd$]uB_ u Yu 1]u]ÐD$F D$E$Ux׋ ΐUd$u։}lj1tE <$D$F D$Uu}]Í'Ud$MEU ME 듍vUd$MEU ME pUd$MEU ME PUd$MEU ME 0Ud$MEU ME Ud$MEU ME U1҉d$E 1uÐt&E$UÐt&Ud$؉]u]Y u }}1t)Gv @TuD$F$?t|$4$U]u}]Ðt& ]u}]Ív'Ud$؉]u] u }}#1t)Gv @TuD$F$?tt$<$U]u}]Ðt& ]u}]Ív'UVd$u 1tF D$E$Ud$^]Ív'Ud$؉]uB\ u }}Su1]u}]ËGV uLt&t>@UuM;HLt0@ D$ sD$D$$$/1뜐T$D$<$U҅x ufUWVS[A d$B;Gt?G D$F D$ ED$D$$$.1d$L[^_]Ðt&;uU}U &u}؋}uwu9Mu܋}ts9Et'G D$F D$ ED$K&U؋BU;t}URh9‰UtbUEU؋uEU9Pu;Qu tMԉD$$IMjU؋BUU뷍P;AhED;PDr'Ud$ȋMuu ]YØ }yFPTFUtGUu2D$$$,]u}]ÍW$M‹MҸtʃq1҉uG<$P1몐t&@ D$TD$$$W,z0D$$$NVU1҉SXÕ d$E@H~PP$Jd$[]ÍUSXW d$܍ED$ ED$D$E $,1tED$ED$E$Ud$$[]Ít&Ud$]E7X D$DD$E u}u$N,E@@T4$'DžtiF<$D$A1tED$D$4$h#҉tMt҉uVEԉ4$REԋ]u}]f]u}1]Ð4$tWEԉ<$RE뢍&D$$$L1fUd$ȉ]}uJWø }u%D$|$$"]u}]Ít&pD$t$$щ1tD$|$4$\"҉uV4$ERE]u}]Í'Ud$ȉ]uRV u iu 1]u]ÐF EED$E$U|t $|ItUP UP믋M҉t%M҉uUJE$QE|UJE$QEǍt&'Ud$؉]EU> u}|$$Bt]u}]Ë0|$$v(ۍUS U d$싓t$sd$[]Ít&$‰1ufUWVSTà d$W4$D$>EEC4$D$>D$$E:UĉNjtG@WF4$D$<>D$$E1:UĉE܋TEEEIF@W> E؃F@W M EЃ1҅EU䍃 $D$=OUĉMA$FƋUċME̅ɉF ~1U̐t&T @9ȉT uŰMЋE؉L$M܉T$UĉD$L$ t$$g0EȋUt&@ D$D$$$&1EEEEEEM1EuM̋AUĉ $PEUątXt]uԅtMԋ\M܅tM܋EtM}؅tM؋uЅtMЋMtMt;tu B$PEȍd$\[^_]Í&B$P7fAUĉ $PU봍&AUĉ $PU9t&AUĉ $PU:t&AUĉ $PU;t&AUĉ $PU뼐F4$P1F4$P됍'US0K d$ED$D$;$,d$[]É'USJç d$ED$D$;$+d$[]É'USJg d$ED$E $C!1t u|d$[]ÍPd$[]Ð&USPJ d$ED$E $1t u|d$[]ÍPd$[]Ð&Ud$uu]IÛ FUuFXt$h&]u]ÍoD$$7t,Pt/t$D$$ҋ]u]Ít& 琍t&]u]Ít&'Ud$ȉ]u}EB,I HTU$T$K+u_lD$4$@PTyq9~tlE<$D$}+UtS]u}Љ]Ít&FV]u}Љ]ËEUD$4$*UuGFU&tETD$$$=1ҋ]u}Љ]fЋ]u}]ÍG<$P밐t&#;뤐W$$1҅l"t&Ud$ȉuu ]}Gx Et; t P Džt]u}]fH;t(t$D$ @ $D$*]u}]Ë@MMu1D$D$ $EUtًOOp HPiUSG÷ d$Et$@Uu;xLt3@ D$ sD$D$$$p1랍t&E4$D$ED$ׅx ut&'USAç d$̋ EED$ED$ۤD$E D$ D$$1tED$ED$E$Ud$4[]Ít&'USpA' d$̋ EED$ED$ۤD$E D$ D$$y1tED$ED$E$Ud$4[]Ít&'UWVS@ã d$ԉET$$6|-tF~GE~.1 fv9u~ T Eyd$,[^_]fd$,1[^_]ËEt$$,yА&UWVS^@ d$$;EtLEt?GE~51&G @; tUD$$ ,xv9uԋEd$,[^_]ËUtEEd$,[^_]ËUB$PߐUd$]u?^ ƍ 4$D$)t(PBWt]u]Ðt&ɉt1{24$ $eE1h<NjNDž1׉9~iN ;A}ۋ T$I D$$:yUe3$L[^_]Ít&<$$D$D$ ƍ>DžED$ T$D$$ @D$ )T$D$$ ҉t2t!pwƄ,Ƅ5IAW<$R뷐D$)T$ D$$ fD$$$1G<$P &'Ud$]u2; u Iu ]u1]ÐD$F D$E$Ut ]u]Ku⍶'US:w d$̍ED$ED$ۤD$E D$ D$$ud$41[]Ðt&ED$ED$E$Ut d$4[]uv⍴&'US : d$܍ED$ ED$D$E $2ud$$1[]Ðt&ED$ D$ED$E$Ut d$$[]u'US9G d$̍ED$ED$ ED$vD$E $ ud$41[]ÍED$ ED$ED$E$Ut d$4[]ut&፴&'UWVS8ã d$ԋtwD$$$Ƌ Gt&x+W 9Jut$D$<$/d$,[^_]Í&t$<$$҉uًVE4$REȉU$3ljUb Ud$ȉ]u8 }u D$E$ u1]u}]ËNUM܍A$D+NjUMtыEɉG ~ 1U䍶T @9ȉT uUE$UD$|$%ɉUtO ɉ sJE܉$QE_t&z$=#&OE܉<$QUE띍U1҉d$]E 6Ü u1u]u]Ít&E$Uu fu֋$&#čU1҉d$]E u6, uu]u1]ÍE$Ut4$]u]Í uݐt&Ud$ȉ]}6ù } uut8 UG9P(tV$T$ t&4$U|$҉# tW1]u}]ËFW@ R D$ D$D$$T$$]u}1]Í&4$롍U1҉d$]E 55 uNu]u1]ÍE$Ut4$x]u]ÍS uݐt&US4Ç d$EPt3J PҍtB D$L$P$d$[]ÍvPtB D$$Vd$[]Í&Ud$ȉ]uG4 ƋE}D$B$9t[ED$F$!D$|$$c)҉tP҉t-x]u}]Ít&&]u}1]Ít&WE<$RE&VE4$RE럍&&҉uG<$P낍vU1҉d$]E E3 u^u]u1]ÍE$Ut4$]u]Ícuݐt&Ud$]u2É u u ]u1]ÐF D$E$Ut4$]u]Í&u܍'US`2 d$U ERu(t PBW u 1d$[]f$tt&E3@9ttD$0D$$d$[]Ðt&p9uftD$$$6'ct&Ud$ȉuu]}18 F} UHTx ]u}]Ít&OyTy݋@(u֋I(uσtS8tHu19tyP뭍D$0D$U$1ɋUxn|1919191919냋|1'Ud$؉]uw0. Ƌ}$D$tx]u}]ut&F@4tڋtԉ4$ЅIt&Ud$؉]u/é u }}u]u}1]ËV 6t/D$t$<$Ut# ]u}]fuƐt&u͐t&Ud$D$ D$]EG/ D$ED$ۤD$E u}u$gu]u}1]Ít&Unt/E|$D$4$Ut$ ]u}]Ív+u uˍUd$؋E ]u}.8 xuu)P t8|$4$U]u}]Ðf]u}1]Í&1u빐UVS. d$ЍED$ۤD$E D$ D$$(u d$01[^]fD$E$tEt$$Ud$0[^]Ðt&uۍ'UWVSn-% d$ԋ8ul01҅0t0Ut&$FtIvu)iַm۶D$D$ T$<$ǃ8d$,[^_]Ít&E$"몍t&'UWVS,u d$ԋU B;uUzdOMAVtFu V R;u%9u|d$,[^_]Í&M1tߋru~O1&M $L$ v9u~D 9Pű@ ͍&U NjB;zM ydmEo]uE p vU  ɉ t/vM  t&u NjF;sP$R뿐t&Ud$؉}}]u!+ ƅtRFL$$S%tPt"Nt$L$$ҋ]u}]Ðt&]u}]É$h1uʍt&Ud$؉]u*N u}4$Jt]u}]Ðt&uD$0$9 Ud$؉]u'* $E}^u]u}]ÍE4$D$E D$Njt-t; u,1҉uG<$P1뤍&F4$PȋG@ D$D$$$ZG<$PNUd$ȉ]u7) ur$}lt~$t!D$D$<$҉t5Ƌt]u}]ÐG<$P]u}]ËVE4$RE뺍&W$t4҉t4$NƋ]}u]Ðt&P$R׋F1@ D$QD$$$WBv'Ud$ȉ]M'î u֋} $*t|t$$1tD$t$<$҉t-҉uWE<$RE]u}]ÍVE4$RE&k ]u}]Í'Ud$ȉ]M' }uA ?9xdtd U B9xdt@]u}]Ðt&UDʉ$E 9uыuF4$P벐t&EU $ȉM} M9usF4$PMbUVSO& d$q$E1t!E4$D$E D$?҉t d$ [^]Ít&V4$EREd$ [^]É'Ud$ȉ]u%~ u$s$}t; untS q$҉u P$R4$Ɖ]u}]ÍvG<$P뢐t&D$D$$‹ҾtB@Wu}$U"ƋUuDB$P9&lq$54$ƃ;D'$UP<ƋUz&GU<$PU=t&Ud$ȉ]u'$޽ u(#s$}\tVD$D$$҉t]u}]ÍW<$ERE]u}]Ít&t$F@ D$$w]u}]fUd$ȉ]ug# u,Ys$}tVD$D$$҉t]u}]ÍW<$ERE]u}]Ít&u]u}]&Ud$ȉ]u"n ֍x$lq}t$$1t'D$D$<$EUƋtxt]; uu҉t ]u}]ËF4$P]u}]Ðt&]u}]ÐG<$P또t&B$Pzft\4$҉tt%|/ot&VE4$REuA1Ud$؉]uG! u}} F9H(t9G9H(tG9s]u}]Ív]u}]Ðt&MM‰ ¸|fUd$ȉ]u ^ u}ED$ED$E$Ks$-t2D$D$$tk҉tHt-E܉D$ED$E$.]u}]Ít&G<$PȐt&P$Ruf<$`떍Ud$ȉ]En $U Eu}ua}t >U$ƋUth$UD$t$ ɉUtr ɉ t]u}]fJE$QE]u}]Ít&stF]u}1]É4$|$EAƋUl&NE4$QUEwUD$0$1bUSG d$܋EUM tXD$L$$D$ D$D$t1҃ɉu P$R1ҍd$$[]ÍBL$D$ $D$D$.몍US× d$썃 D$ D$D$E$d$[]Í'USG d$܋EUM tXD$L$$D$ D$sD$t1҃ɉu P$R1ҍd$$[]ÍBL$D$ $D$sD$.몍US× d$܋E D$BD$ D$D$E$d$$[]ÍUSG d$܋E D$BD$ 0D$pD$E$d$$[]ÍUS@ d$܋E D$BD$ 4D$pD$E$=d$$[]ÍUSç d$܋E D$BD$ HD$pD$E$d$$[]ÍUSW d$܋E D$BD$ LD$pD$E$d$$[]ÍUSP d$܋E D$BD$ PD$qD$E$Md$$[]ÍUS÷ d$܋E D$BD$ TD$ qD$E$d$$[]ÍUSg d$܋E D$BD$ XD$qD$E$d$$[]ÍUS` d$܋E D$BD$ \D$cqD$E$]d$$[]ÍUSdz d$܋E D$BD$ `D$%qD$E$ d$$[]ÍUSw d$܋E D$BD$ dD$.qD$E$d$$[]ÍUSp' d$܋E D$BD$ hD$7qD$E$md$$[]ÍUS ײ d$܋E D$BD$ lD$@qD$E$d$$[]ÍUSÇ d$܋E D$BD$ pD$IqD$E$d$$[]ÍUS7 d$썃 D$ tD$grD$E$d$[]Í'US0 d$썃 D$ xD$qrD$E$4d$[]Í'US× d$썃 D$ |D$yrD$E$d$[]Í'USG d$썃 D$ D$rD$E$d$[]Í'US@ d$썃 D$ D$rD$E$Dd$[]Í'USç d$썃 D$ D$WD$E$d$[]Í'USW d$썃 D$ D$rD$E$d$[]Í'USP d$썃 D$ D$rD$E$Td$[]Í'US÷ d$썃 D$ D$rD$E$d$[]Í'USg d$썃 D$ D$rD$E$d$[]Í'US` d$܋EUM tXD$L$$D$ D$qD$Rt1҃ɉu P$R1ҍd$$[]ÍBL$D$ $D$qD$몍USg d$܋E D$BD$ D$WD$E$d$$[]ÍUd$ȉuu]}Q } ucEt$D$*rD$ D$rD$E|$$3…tO 1ɉ uGB$P]u}1]ÍPuD$0D$$ns]u}]Ít&t,uD$0D$$"xE|$D$rD$ D$rD$E$\$t&USǬ d$܋EUM tXD$L$0r$D$ $D$qD$t1҃ɉu P$R1ҍd$$[]ÍL$D$ $(D$qD$몍US` d$܋uAED$E D$D$ ,D$5rD$E$Jd$$[]ÍvuD$0D$$1yʍt&UVSÆ d$ D$ 4D$BrD$E$t=$҉tx3d$ [^]ÍVE4$REݍ&d$ [^]uꍃJrD$$륍t&'Ud$ȉ]Eþ $U Eu}u}t >U$@ƋUth$UD$t$ɉUtr ɉ t]u}]fJE$QE]u}]Ít&tG]u}1]É4$|$EƋUl&NE4$QUEw sfUd$UM ]u}Õ BQ9tMJ0tFPV9H0tPV9tgu# ]u}]Ðt&1ȍt&EU D$$BD$ 8D$oD$0]u}]ÍvtD$$hutB E T$ UD$$<D$oD$9OM QM;Q=!G<$PfU Eo4$DpEM BD$T$ 8UD$t$ $O U912GU<$PU'Ud$UM ]u}ŧ BQ9tMJ0tF X9H0t X9tgu# ]u}]Ðt&1ȍt&EU D$$BD$ @D$oD$`]u}]ÍvtD$$utB E T$ UD$$DD$pD$9OM QM;Q=!G<$PfU Eo4$tpEM BD$T$ @UD$t$ $ U912GU<$PU'Ud$}}]uE > 7F@0tY9HDB@0t Y9HDt]u}]Ét$B$D$ D$oD$; @@W~ FF U t1wF4$P1gT$BUD$ 4$D$oD$"UtQ; tu@@WyA AU rA $P1F4$PAU $PUw$D$$$uF4$P[$D$$M$MLA $PvUd$UM ]u} õ BQ9tEJ0t>0\9q@H0t 0\9y@teu! ]u}]Ív1͍t&EU D$$BD$ D$ pD$X]u}]ÍvtD$$utB E T$ UD$$D$pD$9QM QM;Q?#G<$PfU E p4$lpEM BD$T$ UD$t$ $w U912GU<$PUUd$UM ]u}> BQ9tEJ0t>]9q<H0t ]9y_9q8H0t _9y8teu! ]u}]Ív1͍t&EU D$$BD$ D$-pD$]u}]ÍvtD$$utB E T$ UD$$D$6pD$y9QM QM;Q?#G<$PfU E-p4$pEM BD$T$ UD$t$ $ U912GU<$PUUd$UM ]u}u BQ9tEJ0t>pa9q4H0t pa9y4teu! ]u}]Ív1͍t&EU D$$BD$ D$>pD$]u}]ÍvtD$$PutB E T$ UD$$D$JpD$9QM QM;Q?#G<$PfU E>p4$,pEM BD$T$ UD$t$ $7 U912GU<$PUUd$UM ]u}õ BQ9tEJ0t>0c9q0H0t 0c9y0teu! ]u}]Ív1͍t&EU D$$BD$ D$UpD$X]u}]ÍvtD$$utB E T$ UD$$D$apD$9QM QM;Q?#G<$PfU EUp4$lpEM BD$T$ UD$t$ $w U912GU<$PUUd$]UG ; u}ut/F@0td9H ]u}]ËM FQ9J0d9yɉMH0td9y}tBD$ D$RqD$E t$$pvvM T$D$ L$4$D$[qD$=fEjMtD$$iunEB M L$D$T$ [q4$D$9M Q;V G<$PU Rq<$LwD$E B|$T$ Ut$$Z U9TE9GU<$PEU&Ud$UM ]u}Ř BQ9tEJ0t> g9qH0t g9yteu! ]u}]Ív1͍t&EU D$$BD$ D$lpD$h]u}]ÍvtD$$utB E T$ UD$$D$xpD$ 9QM QM;Q?#G<$PfU Elp4$|pEM BD$T$ UD$t$ $ U912GU<$PUUd$UM ]u}N BQ9tEJ0t>h9qH0t h9yteu! ]u}]Ív1͍t&EU D$$BD$ D$pD$]u}]ÍvtD$$utB E T$ UD$$D$pD$I9QM QM;Q?#G<$PfU Ep4$pEM BD$T$ UD$t$ $ U912GU<$PUUd$UM ]u}E BQ9tEJ0t>j9q H0t j9y teu! ]u}]Ív1͍t&EU D$$BD$ D$pD$]u}]ÍvtD$$ utB E T$ UD$$D$pD$9QM QM;Q?#G<$PfU Ep4$pEM BD$T$ UD$t$ $ U912GU<$PUUd$UM ]u}Å BQ9tEJ0t>`l9qH0t `l9yteu! ]u}]Ív1͍t&EU D$$BD$ D$pD$(]u}]ÍvtD$$`utB E T$ UD$$D$pD$9QM QM;Q?#G<$PfU Ep4$<pEM BD$T$ UD$t$ $G U912GU<$PUUd$UM ]u}ő BQ9tEJ0t> n9qH0t n9yteu! ]u}]Ív1͍t&EU D$$BD$ D$pD$h]u}]ÍvtD$$utB E T$ UD$$D$pD$ 9QM QM;Q?#G<$PfU Ep4$|pEM BD$T$ UD$t$ $ U912GU<$PUUd$UM ]u}N BQ9tEJ0t>o91H0t o99tgu# ]u}]Ðt&1̍t&EU D$$BD$ D$pD$]u}]ÍvtD$$utB E T$ UD$$D$pD$I9OM QM;Q=!G<$PfU Ep4$pEM BD$T$ UD$t$ $ U912GU<$PUUWVSU d$ԋ}r$BE$D$D$4$o‹B;l;}H rBrL$ EǿD$HD$$U$ Ut_҉u F4$Pd$,[^_]Ðt&GU<$PU[뽐$U荿UNjuB$Pvt뗍Br$Eu]'Ud$ȉ]}Þ }q$uu tut$$E1NjUt($D$D$ƋUtDt)4$耾҉t=]u}]t_]u}]Ðt&B$P뱐t&V4$ERE]u}]Ít&G<$PUp&D$t$<$輳r Ud$]u^ u}U} N $UMD$UMt?D D t$D$T$ |$$Ɖ]u}]Ít9t]u}]ǁt&UM$蔱UMM1땍t&UWVSu d$ԋEEE EE䋓 ҋpn= 4$D$4$D$ti9FtSE$E‹t[uGU܉<$PU܍d$,[^_]Í9FuED$E$3묍&FU܉4$PU딍&`IFHEE EEd$,[^_]0U܉$UOE$E=3$1$s$ǯ v1v'UWVSå d$ԋ0}*D$G$1@E $$ENjUP D$D$4$҉t,҉t d$,[^_]ËV4$EREd$,[^_]ËWE<$REÍ&W4$T$|$ЅQ1d$,[^_]Ðt&u B$Pt؋u͋F4$P1dt&W$J01뚋0D$0$^1y Ud$]uG ƋttM@0-t&UȋBEfu̅EЋM̉d$L[^_]ËMIMft&UWVu }t&vu1^_]fUWVSN d$ԋE@E*U B@Wu䋾 Ou1V;W u f9T t@9p9|#&;v9T BxTy܋U MT$$tMtɃ‹@uF ;F$DƋuUt$D$ыU ɉ uOJ$EQE>fz ֹ WE UD$$Vd$,[^_]ÐB :&UWVSÅ d$ċE@D$E$袢@@WMUD$ $EU1ҋUtlB Eԍ`uoMED$A U܉D$$U܋ ɉ tsM҉uQE܉ $RE܍d$<[^_]Ð ɉ tU1SMEԉL$ MD$L$$U܋ ɉ uJE܉$QEy$P1vEUMUT$A D$$I5UWVS> d$ċED$$6@@WMU܉ $D${EM1ɋUE=@UD΅҉MJ`M uuouEԋN D$L$U܉$uU܋ ɉ tsM҉uQE܉ $RE܍d$<[^_]Ð ɉ tU15MEԃuL$ D$t$$U܋ ɉ uJE܉$QEy$P1vEUMuԍQ t$T$$5t&UWVSU~ d$ċuU t F@TxtU$^UB@W.z#z GHTUt$<$sUGUuk@UtbuB$D$D$ѹ1txET$UD$<$U ɉ uSJE$QEB;t@ D$G D$ F D$D$$$賶1d$<[^_]Ë@ D$ F D$D$$$耶d$<1[^_]Ðt&F D$D$$$O1뚋F W D$D$D$$T$T$ $1cUVSv| d$Eu t PBW t F@WuX4$D$D$XƉD$ED$$҉uVE4$REd$ [^]Ðt&FtttD$$$f$[Hː&Ud$ȉ}}]uÈ{ GUu F@WV$U調;FUuJtW 1]u}]ÍHU$QUːlxD$$n봍&G D$D$$$?녋@ D$ G D$D$$$SG D$ Ud$ȉ]ENz uD$u.E$u]u]ÍED$ED$ D$)D$E $ktU; t1u$UUVUV F1E1܋E袖uUfUd$ȋU ]u}xy RuҋEuEt PBW u(FVD$4$]u}]É$ t̍t&p9tJ39tTD$0D$$y]u}1]Í&39^D$$$n]u}1]Í&D$4$ S$T$D$|$$3pT$ UL$$nL$舢U$EBUMt+D$ F D$D$$$3UMuAU $PUuB$P&{G<$P1 ׷U$0pUu뱐UWVS^w d$u} Ftt@UtHЋu4$謨taWBW ҉8t t11$t4Pt'|$t$$ҍd$[^_]ËB$P1뭋F@ D$4D$$$ǯ뽋B D$p؍4D$0$돍UVS?u d$uFt t&t@Ut0Ћu4$茧tytfd$[^]Ðt&t%PtNt$L$$ҍd$[^]ËF@ D$4D$$$ή1t덍4D$0$1륍&UWVSNu d$ԋE@E܉p\U9uqQt[Ap~S411M9~9v~uFMtMU؉L$$M хUtʍd$,[^_]ÐMq\;utU܋;t(M $+ttU$T$M хuE@UtU$T$M хu1tEU MD$T$ $֍d$,[^_]Ðt&UVS/s d$uFP@N V@BF4$t҉ft҉5t҉t҉t҉t ҉tuFX$t ҉t=t҉uP$RF4$d$[^]Ðt&P$R벍&P$Rwt&P$RJt&P$Rt&P$Rt&P$Rt&P$RUWVSNr d$MyGU@uot $MЋMԋ1~ d$L[^_]ÐQG9u G9tUЉ $ЋUЋuËB$Pd$L[^_]Ív $M}1M|}9wuE܍v9ptE܋WhtE܋@h9QUzt}lMԉ$2MԋE䋓d@AU@BdP $MMԋ~52t@d$L[^_]Ðt&UBBQEQ@BAWhtiG<c;RsD$Uԉ$9UvTuGT!Et&t ;hF D$D$$$蹛t&F0,O0ɉMu܅tM܋u؋I0;M؉vF4$P/fGPU|$$葫f t$GD$E$ &E@[Gh95 $t&uM܅tM;GhFhE#GTmO0I0ɉMu܅tM܋u؋I0;q0M؉H0F0qO0I4ɉMku܅tM܋u؋I0;q4RM؉H4F0>O0I8ɉM8u܅tM܋u؋I0;q8M؉H8F0 O0I<ɉMu܅tM܋u؋I0;q<M؉HK d$ĉE@EEE1!ET$Uԉ$>Utg9}~EEt F;tHTyfL‹Eu9}܉Uuu؅tuE؍d$<[^_]Í&E$D$Uu`fPD$$$EE؍d$<[^_]Ív4$vh؍뼍&'UWVSJ d$E܋E܋EPЉU$3EtgE1&MT BxTxUU$NjUtotHuԋ$EE̍d$L[^_]Ë$TtNjUԋB D$dD$$$3wuԋUF ( uN1tED$E D$F$襀]u]ÍvUd$]u7' u¸t F$pi]u]Í&'Ud$]uÞ' uF;t;t4$袊]u]É1tvڍUd$ȉ]u臍>' u}} F9t2;t*G9t;;t3|$4$c]u}]fUUtvft1ōt&Ud$ȉ]uî& u}} F9t2;t*G9t;;t3|$4$Wm]u}]fUvUtvfat1ōt&Ud$ȉ]ug& u}} F9t2;t*G9t;;t3|$4$]u}]fUUtvft1ōt&Ud$ȉ]u׋Î% u}} F9t2;t*G9t;;t3|$4$Wd]u}]fUVUtvfAt1ōt&Ud$ȉ]uG$ u}} F9t2;t*G9t;;t3|$4$R]u}]fUUtvft1ōt&Ud$ȉ]u跊n$ u}} F9t2;t*G9t;;t3|$4$Q]u}]fU6Utvf!t1ōt&Ud$ȉ]u'# u}} F9t2;t*G9t;;t3|$4$f]u}]fUUtvft1ōt&Ud$ȉ]u藉N# u}} F9t2;t*G9t;;t3|$4$WM]u}]fUUtvft1ōt&Ud$ȉ]uþ" u}} F9t2;t*G9t;;t3|$4$Z]u}]fUUtvfqt1ōt&Ud$ȉ]Uw." u}B9M utG;t?A9t`;tXtF9tm;tet$L$$q]u}]ÉЉUMUMt R륍t&1ύt&ȉUMUMtI댍t&UMUMtv|Ud$ȉ]u藇N! u}} F9t2;t*G9t;;t3|$4$P]u}]fUUtvft1ōt&Ud$ȉ]uþ u}} F9t2;t*G9t;;t3|$4$Wt]u}]fUUtvfqt1ōt&Ud$ȉ]uw. u}} F9t2;t*G9t;;t3|$4$U]u}]fUUtvft1ōt&Ud$ȉ]uÞ u}} F9t2;t*G9t;;t3|$4$'v]u}]fUfUtvfQt1ōt&Ud$ȉ]uW u}} F9t2;t*G9t;;t3|$4$Y]u}]fUUtvft1ōt&Ud$]uDŽ~ uF;t;t4$`]u]Éi1tvڍUd$]ug uF;t;t4$RX]u]É 1tvڍUd$]uþ uF;t;t4$r|]u]É1tvڍUd$ȉ]u觃^ u}} F9t2;t*G9t;;t3|$4$s]u}]fU&Utvft1ōt&Ud$ȉ]u u}} F9t2;t*G9t;;t3|$4$7i]u}]fUUtvft1ōt&Ud$ȉ]u臂> u}} F9t2;t*G9t;;t3|$4$U]u}]fUUtvft1ōt&Ud$ȉ]uî u}} F9t2;t*G9t;;t3|$4$c]u}]fUvUtvfat1ōt&Ud$ȉ]ug u}} F9t2;t*G9t;;t3|$4$O]u}]fUUtvft1ōt&Ud$]u׀Î uF;t;t4$bL]u]Éy1tvڍUd$]Ew. up=¸t4$rL]u]Ud$]u7 uF;t;t4$P]u]É1tvڍUd$]uÎ uF;t;t4$rO]u]Éy1tvڍUd$]uw. uF;t;t4$bN]u]É1tvڍUd$ȉ]U u}B9M utG;t?A9t`;tXtF9tm;tet$L$$MR]u}]ÉЉUM{UMt R륍t&1ύt&ȉUMSUMtI댍t&UM3UMtv|Ud$ȉ]u7~ u}} F9t2;t*G9t;;t3|$4$D]u}]fUUtvft1ōt&Ud$ȉ]u}^ u}} F9t2;t*G9t;;t3|$4$B]u}]fU&Utvft1ōt&Ud$ȉ]u} u}} F9t2;t*G9t;;t3|$4$U]u}]fUUtvft1ōt&Ud$ȉ]u|> u}} F9t2;t*G9t;;t3|$4$gV]u}]fUUtvft1ōt&Ud$ȉ]u{î u}} F9t2;t*G9t;;t3|$4$e]u}]fUvUtvfat1ōt&Ud$ȉ]ug{ u}} F9t2;t*G9t;;t3|$4$_]u}]fUUtvft1ōt&Ud$ȉ]UzÎ u}B9M utG;t?A9t`;tXtF9tm;tet$L$$E]u}]ÉЉUM;UMt R륍t&1ύt&ȉUMUMtI댍t&UMUMtv|Ud$]uyî u1t F$>]u]ÐUd$]uyn u~1t F$#[]u]ÐUd$]uwy. u>¸tED$E D$F$re]u]Ud$ȉ]u'y u}} F9t2;t*G9t;;t3|$4$N]u}]fUUtvft1ōt&Ud$]uxN uF;t;t4$"H]u]É91tvڍUVS?x $0EeU1ҋPTT$RR D$ T$D$D$4$G4$TUe3u $[^]1QUd$ȉ]uwn u}} F9t2;t*G9t;;t3|$4$f]u}]fU6Utvf!t뽸Ud$uu]$w F t4$A4$A]u]Í'Ud$]uvÎ u4$AfF4$]u]UWVESvR d$ED$ED$zD$E }D$ D$$8EPBT@rhU; 40t H 1trD$<$tMUM@HtP Ut J @PtBf1d$\[^_]Ðt&;ut፴&EPrh1Ht&9HEDf;t@҉PufB D$D$$$OH1bE9zt@y;}t;t MąHQPQtBAd$\[^_]ËJu։Uăy u몍UStG d$̍ED$D$D$E D$ D$$6d$4[]ÐUd$؉]u7t }}EU t ]u}]ÍvH;Juߋp 9t#z9tD$|$4$T뾍9t |멋PUSsg d$썃D$ ZD$ED$E $K1t E@d$[] Ud$؉uu]Ds Ft ]u]ÍvV; t$[F]u]ÍdT$$E${hE뱍&'UWVSrÅ $}eE1G;  $T$\@@Wu~GD$D$@@ |$ D$D$8D$<$!Btu F4$P<$NUe3$<[^_]Ðt&GVD$T$@@ |$ D$D$D$<$Af|$ ~D$D$<$|An&dvJUd$D$D$$]uXq =t҉u P$R]u]É4$K썶UWVSq d$ċEPBT@zh<87F 4$t$VVtӋuȋFP$RfEǃd$,[^_]fUVScF d$t ҉tTǃ1DŽvt"t҉uԋP$Rɐad$[^]ËP$R롐&USc÷ d$E$Ud$[]Ít&'USbÇ d$EPT$@ D$$f`d$[]Í&USbG d$E@$Sd$[]ÐUd$]uWb ue$?1tpV N҉P tP]u]@]u] UWVSaå d$BMA} GM}0;puԉxUI{Ut}t9wMԋUEfMԋUE;}ρ}}u7u }ԃ?}D$$V1ɍd$<[^_]ÅM)M|2} Ju܅ EUx9v r{0t(}t9w鍃yfmM~=ɐMEx봋M)M}ԋM9mmfE}+UuE @UM9 MQ!t:t9v ыQ!u!E}:u{EHM qMQML9d$<[^_]Í&2}Bqt&}{vBuEP뗋}E @UU9s:}M B;AsM B:Rt (}W2&US^× d$썃D$$$KTd$[]Í&US^W d$U ҋEuUH @d$[]Í$D$$Sҍ&UWVS>^ d$ԉE܋0;psQ1=t&E EgfffmE)9u0E܋}ύv9pv$Jyd$,[^_]ÍD$$0d$,[^_]ÍUd$ȉ]u}H]8 ;Hu s.9I.Ht0[t[D$1$R]u}]PHPM9UvJ z.xt:[t5PHPM9U:J]HtNfPVE;FrTD$f1$$RP&V6Uu11&뢍v3'UWF M &UWVSWå d$ԉE1ҋuIHuMA)9)9EtMQ ~1M f @9uM EP MQI L$T$$V4t$EUxz ~1M f @9uMMEd$,[^_]Ít&U䋃(9B3ِD$$fLEEd$,[^_]ÍvE Ud$]EVN D$ D$ ED$D$E u}uE $V1t.NU9| (9~t'E)ʉD$$(]u}]ÍvvUd$]EUî D$ D$ ED$D$E u}uE $1t,VM9| (9~t'E)щD$1҉ $]u}]Ðt&vUd$]EWU D$ D$ ED$D$E u}uE $1t>NU9| (9~t7Ѓ)ȉ!ʋM)ЉL$$]u}]ÍvvUWVESTb d$ED$mD$E $EH @E1;ME1E1/fte vt u)9|M<71I9Mv5 űUЅ~}ЋE)Љ¸)9|I9Mԍ4w˸)9}6D$$YI1d$<[^_]Íd$<1[^_]Í7EtH @d$1[]Í'UWV1SHc d$EMU@ E؋IMԋzB 1҅E~-}d$<[^_]Í&'UWVSEE d$}Gw t]t&<9rf6v9v)$u$Od$[^_]Í$4d$[^_]Ív$>uڋG됍'UWVSDå d$}Gw t]t&<9rf6v9v)$Cu$ d$[^_]Í$ d$[^_]Ív$^CuڋG됍'UWVSND d$}Gw t]t&<9rf6v9v)$_-u$ d$[^_]Í$ d$[^_]Ív$-uڋG됍'UWVSCe d$}Gw tjtQ<9rf~v9vq$u$QBu݋$,uϋ$e@u$D d$[^_]Ë$Qu$Bt&$ d$[^_]Ë$9,u݋$?uϋG:&UWVSBu d$}Gw t]t&<9rf6v9v)$?u$ d$[^_]Í$d d$[^_]Ív$^?uڋG됍'UWVSB d$ԋ}Gw tutA<9sRf<u%v9v6vU$2Ut$ d$,[^_]Ív$ d$,[^_]Ívw<uЋGk$2'UWV1SLA d$ĉU؉E}P @EE~FMt&<t*v9~#vUԉMЉ$2UԋMuٍvEߋ}؋Mu0}tE(9xtz)L$${9d$<[^_]fEߋMu؉ύw;u| fw(<t w;u};}u؉t뢍Uԉ$}1Ut܉Ѓ뒐t&UWVS.@ d$ԋEp @tmE9ƉEEr"{vUuIv9uEEv[><$uՉ<$uɉ<$1&t%Eu$d$,[^_]Ívv9uEwE܉$}d$,[^_]Ít&$ft$Ud$,[^_]Ë$1҅tfUWVS? d$ԋEp @tuE9ƉErJfv9uEv9><$O%uC<$u7MuЉ<$pučv9uwˍt&E$d$,[^_]Ít&$d$,[^_]Ív$&$f؍UWVS>> d$ԋEp @tuE9ƉErJfv9uEv9><$uC<$u7EuЉ<$P$učv9uwˍt&E$d$,[^_]Ít&$d$,[^_]Ív$$$t&UWVd$Jt9ux}4};4u9ɉ8}@ 4z ;uQUUUU;o9_UWVd$u} Mu9Oʅ+M0uUʅId$ ^_]f)Mx9UUUt&M9uU9ҋ}tIm@yd$ ^_]ÍvUq19EOʅnѺH_fEEd$ ^_]fUWVS;U d$u E̸UHBU;B}؋M̋ }QҋI z9LUM؋BQ9)ЉEωʉ}9ỦBtEH ủMȋM؋FQ)օ҉uE^1҉}Đ;UkM؋}̋I M܋1u }ԉUt&Eu9u@ };8uM؋}QMԍr }; uʍ 9uU9U};9UM̉+uЋ}EA <$Ut$D$}ȋUMA~*΋}ȋI <$UD$L$FU<}ȋE؋}PUnmUt}}̋O W}D$D$G $"E̋(9PtyPT$@ $02d$l[^_]ÉD$E$D$벋M؋A E̋x@ ~;Wu@R;yd$l[^_]1}}ȋut&E̋@ RFD$F D$<$UMFMUɍ<}ȋ}ŨB)S!}̋G;E5Ed$l[^_]ËŰB獃nD$$-1+EЋUM̋uQ D$T$4$뤅z|$$0E}̋H GW T$ $D$U؋MB A 8ExE}1}u@9G& O 9umu1ՋŰB$D$0EŰH $BR T$D$5E̋U؋@EԋRUu E+E9M̍4I u܉MʋM؍2A ;uˋuMu u; uMD$$L$um8uUE܋NB v $t$L$M؋űIMvωuS1űFE11t&UWVS.6 d$ԋExp E~(fv$;t EߋEd$,[^_]ÍvUWVS5Å d$ԋExp E~Wf$!E~9v$AuՋ$tڋ$ENjEd$,[^_]Ít&UWVS>5 d$ԋExp E~(fv$H!;t EߋEd$,[^_]ÍvUWVS4Õ d$ԋExp EuEd$,[^_]Ív$&u2f~ڍv$Lt$ EӍv$E뻍vUWVSN4 d$ԋEp @E9so1&v<$X <$t)v9uvEҋ>u׉<$<$eu׉<$uˉ<$1҅uv9uw&d$,[^_]f$N1;tݐ&UWVS~35 d$MɉEIEUE$.EU"}}UȅYE1ҋ@EE+EȉEvR;UMEI Mx 4;u܋HEMԃM؍ E; uM9uE~d+M̋uL$M̉U$_+}ЉD$<$UUȃm;U܉UUE9E} EЍd$l[^_]ËUE+ẺD$EB $*XMЉD$ $-uF4$P럍&FU4$PUh}Ћu G<$P|mD$$#'EEЍd$l[^_]ËUMuf1B E܋IɉMV } 9Ev};|Nu}+MUL$M$)D$EЉ$Udt mu뉋GU<$PUu F4$PuЋ4EEЍd$l[^_]Ë}9}CE)D$$?)t&UЉD$$z]MЋuuЋF4$PEt&EM1@EQ 1ɉ}9u<f}<t.v9u~svU$u UMu9u~Ju܉M؉֋Ut&<u$9~vU$ UtߍvM؋u9|9}yEU)D$$(D$EЉ$:Uth9}~. d$MɉEܸIEUE$p)EWURE@EE̅E܋@+ỦEyBUU‹M܋EI Mx 4;uՋHEMԃM؍ E; uM9u}~hM̋uщU)Ήt$u$&D$EЉ$UUt+ẼmTUuxAM܋UT$A $%EЉt$$}t1UЉ$#xPEЍd$\[^_]fFUȉ4$PUmF4$PUЉ$#yu G<$PMЋEEЍd$\[^_]ËuЋu F4$P|mD$$!EEЍd$\[^_]ËUM܋B EqA EMЉD$ $"u F4$PuЉ4$"%UЋuMЋA $PEE܋pP Mdf<tv$ux<}׋Ut&<u"xvUȉ$RUtv}9{E)D|$$U"MЉD$ $UUtu+F9t ;tDt?]}u]t&D$$]u}]ÉЉUUɸt;VOVA v MT$t$$=MuP$RM1딍D$$StUd$U E'Ud$ȉuƉ]}Md ~)9}a~+G U܉NjF MȉED$F$EU1ҋM؋UxCF@ <>}FF = F <T$|$$2>]u}]ÍUWVSñ $E EZF+$dD$1҅%EP U@EdEF҉U)ЃЉEԍE`E䉅LUȍMЉXTUMP\8Tx L$$]u}]fD$$$&1Ӎv'Ud$؉$]ut+ }t}<$D$qNjt|; tG@TutfU1:]u}]Ít&w 9|xxE81]u}]Ít&]u}]ÍF4$PvD$$$0uG<$Pkt&@D$D$$$뽋$$e`E1&Ud$؉$]u˨ }<$D$ Nj; tG@Tt,w]u}]Ðu鍃TD$$$uG<$1P뷍&1]u}]Í&F4$P^$$zr= _&Ud$]u î u}Mċy}䍻 g9z^; @@VudE W9E}IUɉ4$9LD$URG<$P]u}]ËE B9E6OLu 1҉uƋG<$P]u}1]Ív=@1t^ L:$}M<:L90Mσz(<:|80E E9EU4$9L‰D$ts]u}]ÐR4$9L‰D$M BvE T$U܍AO$L$M Uv6uċu 6uuċMT} 1qt]u}]ÍvG<$P8t&US 7 d$EPBWtPT$@ $ d$[]d$1[]Ív'US0 d$EPBWtPT$@ $d$[]kd$1[]Ív'US × d$EPBWt)D$ D$PT$@ $'d$[] d$1[]Ív'US 7 d$EPBWt)D$ D$PT$@ $d$[]d$1[]Ív'US ף d$EPBWt!D$PT$@ $d$[]Sd$1[]fUS Ç d$EPBWt@d$[]Í&t&US G d$EPBWt@ d$[]Í&1鍴&UWVpSI d$ċMUɈU%t/U un4$L$D$ D$D$ƋUuWuKEtz)@vuUFd$<[^_]Í@0p뉍&lvϋE4$D$D$+D$D$ 7y&Ud$ȉ]u}ƋMM }twL$$st'tJ]u}]Í&|$$uNjED$$uÍ&P$R멍vE|$D$E D$EL$ D$$]u}]ÍUd$]u} r) ɉ֋}E UD$E D$ ED$ED$E$u1]u}]Ðt&D$D$$tЋ@@WED$ (U$D$T$D$4$twU$x@9E|KEtzE]u}]f$REy&D$D$$F4$P1vF4$PxfD$$$믐Ud$؉]uÞ ƋED$ED$ ED$E D$E$Mt$g]u]Ðt&UWVSE d$}EEUE E9EMM&<0t2MR M9UvF2vԉU4$9UuΉU4$UxS@0MR9UԉMwEEt҉+Et҉1d$l[^_]ÍF=wfB9EԉEv^BHvPủUЋ}#t&<t8$u,Pvv܉$dt$tԋUЃ}}CE}E+U+EẺUE܉D$EM̉D$E L$D$ MML$EMD$U䍃$EL$EPUЅҋH M}1*&M<t7G EЍv)~OEȋv҉$U_Uuɉ$UU@0GEЍv)UE܋MMAU $PUt&} }UD$$AD$D$ D$AUEEO&B=iWutu+UL$M+MT$U L$ T$ME $Et҉Ed$l[^_]ËM?MUEUEP$Rd$l1[^_]ËEP$RnutjutY/uE9U J}1v}vT9U @*)}̋}ԋE؋MuЍFU4$PUuЋuF4$P&Et҉u EP$REt҉u EP$RE܅t҉=1$[^_]Ã}E+E19Uԍpv<ЉUċ}ԉuUI@9s vcwr@I9rUċuE+E;MH9Uv9֋}f<$D$ED$ D$D$v;urщ}̋UԿowxIkEtyu}tju}Q9Uv.ҋMыuT&?@9uE̍DE̋UԿ&'w`IUMĉT$U+UuE܉T$ U$UL$t$eUJGMuIEU9ǍE$M|$fUu}u~MU9MȍEL$M$+UM_EMЃE?Bq I Fu}UԿEċUT$D$ EMċu$UEL$t$NUЋB$PEU̍@);U|xEt ҉tEE܅t ҉t%E/u1|E܋P$R͋EP$R뭋E܋P$R1ET$$tuu\&Ud$MEU ME USP d$EPBWt!D$PT$@ $?d$[]d$1[]fUd$MEU ME `UWVSÕ $TUEMe=}1҉EUMEEEEM $L$KE} 7c}E}AEEE|x}vMM}9}  }UM}U$U|$yuM9M Mu gt}tN9G#UD=wUtaNjU T:Ut9UT0Ut׋Uz(|0u9M vzfM}}a}}M9M}MÉ}M}UMUD$ED$ D$!D$$uEÄut&WvaMUL$<$luύ&Et҉Et҉mE)1Ue3$[^_]Ív}M}EL$D$M EtD$||$L$ }D$xUE|$ $0EExp fvEU$D$UbuMɍvtu}U D$EM|$ D$T$}ȉ<$EU9PDEt҉JEt҉Et&u9u}&v9uEUD$?<$lufnutju8E/uE &҉EP$R1EP$R EP$REP$R[ET$$)EP$R}UDpCp; $ B$PEE9E4Et&E UL$D$$EUT$ D$UE M}D$$ȍ|$?UEExB$PjMt;|EU|$D$ T$M }tL$<$EA $P뺉‰MB$Pn&'USç d$U ҋEt3HAWt*D$ T$PT$@ $Td$[]Ðt&d$1[]fUSG d$EPBWt!D$PT$@ $d$[]d$1[]fUd$M(]u}E(ߋ }RUԋU t+$T$Ż]u}]ÍvUM L$MD$D$ ED$EL$$U tD$D$$Jt@@WD$$$҉^V4$EREЋ]u}]fMU D$$RU M L$$fM Dt&ED$ED$ (4$D$D$趹t~U9UEH MċM,xE)9EMEE$UUM0MĉT$UЉL$$XE0UU,1:$ &U҉U^D$T$$'U9MЋE(xE(M,B U02&UWVSU $tuEEEEE EvM …P u EUƋ(uu9N^ EU3t&F=UԉUԋEE9E$UMD$ $ܾƋF@Tz;u~m9}EԋN L$T$U$R)}UUԋ:F4$P,t&UԋE+P ;PEЅt҉E̅t҉u E̋P$RU؍$[^_]ÍG<$P$$ ƃfV EԋEdvEԍ EE+MP UPʍE؉MCMx4U؋E+EMB ED$$$u F4$Pt&EЅt҉2E̅t҉E؅1ҍ$[^_]ÐU؋EԍM+B L$ME܋E+EUЉEEEԉD$(E܉D$$E؉D$ ẺD$ED$ED$E D$ D$$EL$uF4$Pt&҉8E؋P$R1 My quMЉ}ĉM}MԉMMMvM+Eu+Q EM EEU܉D$(UE܉T$D$$UE؉D$ ẺD$ED$ED$E$D$UEL$ t$9EU99Mnuċ \ REUƍUM T$L$$$[^_]fE̋P$R&EЋP$RpEq&EЋP$Rj UWVS> d$} EEEE3脐‰EER MЉUMMMg48MaMvɉ REUEU9y+EċMĉE܃E؋E+P ED$(UԍEԍUD$$T$EUD$ ẺD$E؉D$E܉D$E$D$UE|$ L$wEt҉EЅt҉E̅1&d$|[^_]Í&D$EȍEȉ$d$|[^_]ÍvE+P ;P|BEЅt ҉tHE̅t҉u E̋P$REd$|[^_]ÍE`y&EЋP$R몋҉2E̋P$R1(EЋP$REP$R&'UWVSÕ $tE}EګEċU E HE$mE؋u M؋P EMUԍMƉMMMMU)у)U)UUM+A ML$ E܍EԉD$(E܉D$$ED$ẺD$ED$ED$EM T$$UEL$ |$EU9vJEԋU;`M+U)M_IUM[t&@REԉUfE+P EgxSEЅt҉u EЋP$RE̅t҉uE̋P$R&E؍$[^_]ÐE؅t҉u E؋P$REЅt ҉t8E̅u$1[^_]Ív҉uE̋P$R1됐t&EЋP$R뺍v'UWVS~5 $tE EEҋu …E؋@ Eԋu EMƅɉEU҉Uv}}%}؋EEE}}UM}t&EԉEԋE9)ƒ5M} 8 ʍHMЍ(w9.+EME+EEU؋Eԋ} +B L$ME܍EԉD$(E܉D$$ED$ EЉD$EȉD$ED$ED$ED$ŰE|$ $=U؋0E̅t҉BEȅt҉1ҍ$[^_]Ít&} ~%MA =k=EgU+EE+EEt&wX}<9}} 9 MHMЋMwBEԋ} ׁ8E++EMEEot&+EMEEWt&EtEU}t ME+EE؋U+P EE̅t҉Eȅt҉u EȋP$RU؍$[^_]ÍUEEU*ȍ}؃EEEE}EEEЍM؋EEEME̋P$RSE؋P$REȋP$R1t&E̋P$R US`{ d$܋ED$ ED$E D$ED$$ d$$[]Í&'UWVSz $du} EEEu$EE}t }GEEEEU E HM …AE؋UЋ@ M؉EԉMĉЍM̉MM$MM9) M)UE)EM؋E+A M T$E܍EԉD$(E܉D$$EĉD$ EЉD$EȉD$ED$ED$E$UEL$ t$hhUЉ9dEtME}tM)E؋U+P Er"E̅t҉Eȅt҉FU؍$[^_]Ðt&MM  ʋM  ʋM  ʁv)UEEfEԉUЃEԍB‰E~t&} ~bFV  V ==u2FEEEEEEt&Et&U؋E̅t҉Eȅt҉|1ҍ$[^_]fEȋP$RUFEEEEEEE̋P$RKE؋P$RXEȋP$R1@vE̋P$RG&USPw d$܋ED$ ED$E D$ED$$轢d$$[]Í&'UWVSõv $dEEE EELU E؅Mu @ ΍`EԉučE؉UEF7$uEUEԉEԃEM9MЃv` 499u;u_+u} u)FE~4A%=u$t&@€u 9Ǎ0U䍃M؋Uԍu+Q ML$(D$M܋EL$$MU܉L$ t$M̋uL$$MUЉL$EML$M t$L$ ; EЅt҉ E̅t҉U؋$1[^_]Í&}t U$[^_]Ít&v uvҋ@QqU҉U€h+MMAEE€IMQցƀ+MEMM+MEMM|+MEMMhquQU҉ցƀ+uuFEEE€!FEQE€vuUtU+M E؋U+P Eż:EЅt ҉t2E̅t ҉tE؍$[^_]ËE̋P$REEЋP$RQU€<MԋuU? ?%‰uMquƀquƀ<<u?M?u ?Ɖ1uIMvMԃ?ЉuM}E؋P$R1UE̋P$R EЋP$R}q}Y}Dt&USq d$ED$E D$ED$ $蔰d$[]Ðt&Ud$U ]~q ҉uux^txt.vu0x)tf]u]Ít&u4$D$T$]u]ÍHD$$1묉}u1띰}tP  wUd$]uîp u4$xD$4$ű]u]ÍvD$$>1fUWVSUp $TEEE EE|EM …Xp M E}}MMЉ}Mevuԉ‰M}ɍ@vEuԉ‹u9E\uى+MM8\u݋M&:\uR\9э~U}w)ȨE9U<}Mt}/}`EăGv EREUUvu)E%$IUԉU1wɹU+EEB9EEv z-1&tD E)t4UEU1ɉE΋EMMĉE1}-Eă~UEU1ɉEt&EċMăA}ABM?MEЅt҉u EЋP$RE̅t҉u E̋P$RU؋>$1[^_]ËUĀ` EԋU1ɉEԋUutUEE؋U+P E襭HEЅt҉u EЋP$RE̅t ҉tE؍$[^_]ËE̋P$RMEMĉE1mEԍRU+EԋUU9Uv:-t.1M+UFEUEfUEԹ-EԋUE؋P$R1?% USGc d$ED$E D$ED$ $d$[]Ðt&UWVSNc $dEEE EEEoE"M …=uU @ 򍋕EԉUĉMy0wEUMUԍvUԉuu9u8<\uٍ~+E9}ĉEFEF}U؍}+}}EԍM+B L$ME܍EԉD$(E܉D$$E؉D$ EȉD$ED$ED$E D$ ỦL$ED$ME $RU؅tE̅t҉Eȅ1Ґt&$[^_]f@]u}1]Í&D$$$^1`&$$1=F@ D$ D$$Ƌ1&D$!$¬1vUd$]}GQ }(9ljuU MEEE L$T$$@<$EԉD$t^Eԍ$UyG UtN T$L$$輔EԉGFGt=]u}]Ítt&1]u}]Í&F4$P]u}]É<$hu F4$PONj]u}]ÍE܉L$D$$ED$ED$gD$ D$S14Et7UtM܉L$T$$w M܅u$"}\&USp'P d$EP;(tGBWu!D$T$$wwd$[]ËPT$@ $d$[]Í&d$[]Í&'UWVE܍USßO d$ED$D$D$ ED$kD$E ET$$~EPBWP1uZE9x~qD ${tOE܉D$E$D$Ew҉uVEԉ4$REԅtPd$L[^_]1d$L[^_]Ðt&|d$L[^_]É$F{tЋE܉D$E$D$E9w҉t $}랋VEԉ4$REvUWVE܍USx/N d$ED$D$D$ ED$kD$E ET$$-}EPBWH1uZE9x~qD $UztOE܉D$E$D$EHv҉uVEԉ4$REԅtPd$L[^_]1d$L[^_]Ðt&|d$L[^_]É$ytЋE܉D$E$D$Eu҉t $>|랋VEԉ4$REvUd$]uþL }Ɖ׍E䋔D$ET$UE${UtsE; HITtR$yt6ED$|$4$;M҉uUJEԉ$QE1]u}]ÐDD$$RT$$g]u}1]Ép]u}]f|$4$D$谮]u}]Ít&'Ud$U EJtUɺMp'Ud$U EJtU^ɺ p'Ud$U EJt U1!1o&UVSJ d$E$ywxt1D$$$o1҉t:d$[^]f@ E ҉u܋F4$Pd$[^]ËF4$Pd$1[^]Ðt&hD$$$1됍v'Ud$$]uDI }EEUԉu؉T$uԍU؉T$ UT$T$xtnE9tU$T$utTE9tU܉$T$vut:E$'vt+UM U M܉ ]u}]Í&]u}1]ÐUVSo&I d$ЍUED$E$E u1u d$0[^]ÐMVF ut$ ut$qt$I $rM҉tx-$Ud$0[^]Ðt&UJE$QEӍt&~D$$F1n&UVS蟮VH d$ЍUED$E$E u!1u d$0[^]ÐMVF ut$ ut$qt$I $qM҉t$艟d$0[^]ÐUJE$QEۍt&UVSöG d$ЍUED$E$E u1u d$0[^]ÐMVF ut$ ut$qt$I $gFM҉tx-$d$0[^]Ðt&UJE$QEӍt&~D$$֢1n&UVS/F d$ЍUED$E$E u1u d$0[^]ÐMVF ut$ ut$qt$I $EM҉t$d$0[^]ÐUJE$QEۍt&Ud$]E臬>F D$D$D$ ED$kD$E uU}uEET$$4uu1]u}]ÐE$rtMEUԋV}9|OxQx@ E1)ʋv xBus$(M҉uUJẺ$QEuvU뮍vV҉UyE1뚍vNɉMoEE1dEԋMD$|$ $AHbv'US D d$ED$ED$ ED$nD$E E$su1d$D[]Í&E$5qtEE$#qEtYU$T$EUnM҉t"M҉uUJE$QE뉋UJE$QEʋUaEP$R1PUd$ȉ]EC u}u $opt4$YpE${҉t=t ҉t]u}]ÐV4$ERE]u}]Ít&WE<$RE벍&]u}1]ÐuG<$P1Ud$ȉ]}7B E D$ ED$mD$E u}uE$q1t#U9tPB@Wu'ET$D$4$ ]u}]Í&E$cz]u}]ÍE1҉$Az UWVSn%B d$E$nEE $nEM܋E܋UIM̋M@ ủEЋRUȅI Mu\|mD$$肝EM܋1Uu B$PEԍd$\[^_]Í$$EtU+UEЋMM؋MĉEUt&m@U9uM؉9ɋ}uދUEĉT$U$ MԉA E܃AMċUŰE)ЉD$$ݟUԉBr|MԋEt&MԉA AEAM܋A $PfEEԍd$\[^_]ËUuߋB$PEUԋB$Pi'US@? d$E D$E$3d$[]Ít&Ud$]Eþ? u}$bl@E $Ml@EFW E܋F EEuW|mD$$-1ɋuFM؉4$PM؋]u}ȉ]ÍvU$јUtE$D$U܋EMD$;‹MD$EUԉM؉$֝M؉A yUԋEU)ЉM؉D$E$誝M؉AM7 d$E$dEKE $dE?U9M؋u܋E܋}؋I Mv uPҋO~A~=uE>019t#_t&~#u}tuċt9uč@u;RI9919M؋҉t7u܋҉tFd$L[^_]Ð}9s΋Mظ҉uɋQEԉ $Ru܋Eԋ҉uV4$EREԍd$L[^_]Ít&t!}܍P1҉uU܋B$P1pA $Pu܋ϸVU؋u}؋G<$P4&'Ud$؉]E 臜>6 D$Eu}$}v4$`e]u}]Ívt&͐t&뾍뮍랍덐t&끐Cqn$$ qtҎ Tt&Gv1A,$pt蘎pD$E‰D$$ x1$Fd'UWVS4 d$E$xaEUЋ@ E؋R$UBEuEEMU19M΍<# v9uuvى⅓$tӉ$m[tNjU9u=? vM +E+UE‹U܋M؉D$$D$Eԉ$!t&Uu9}/u$t&+Euu뜍vG<$PUu9|ыMЋu{A $Ppt&;v9uvC}؍H| D0u G<$PMԋu }ԋG<$PUЋtEEԍd$\[^_]ËB$PE+E&'USç2 d$܍ED$dmD$E E$a1tED$E$X{d$$[]É'UWVS莘E2 d$ۤD$E }E E$mLp&I<$E^EMP U@EqdMt>EM@ EyEUEEEdUMȋMȋA@WA UԋPBT$]UȋRUHM̋MMRE9‰U~ M9~;v9EM5zMEUUЋP UЋG UD$EЉT$UM$sUUЋU9UM EE9EMʋMȍEMyMxPEEU3BM$PMMȃuGM<$PMf}tUuBM$PM%Et҉D1d$l[^_]Ít&MԋUȋD GGM<$PM t&EUD$EЉT$$rUMUD$MȋM$M&G<$PMt&1M;EMu A $PEd$l[^_]Ë@@Wt_A (9PUEUEfA $PfEEEE&A 롋EP$R1B MȉD$ EԉD$D$$M$gM*M"E1&USP. d$E D$E$3|d$[]Ít&Ud$ȉ]E- u}$rZt|E $aZED$ED$E$RV҉tW҉t]u}]Í&W<$ERE]u}]Ít&]u}]ÍVE4$RE똍&uŋF4$P Ud$ȉ]E, }u$rYE $]YUMWG L$ ML$NL$N $z+҉t?҉t]u}]Í&V4$ERE]u}]Ít&WE<$RE밍&]u}]ÍMWG L$ ML$NL$N $U[uG<$PS&UWVSޑÕ+ d$ԋE$8XE $#XMFUU;EUNЅG OE܋F E1+Ux ɍB҉t-҉t d$,[^_]ÐV4$ERE؍d$,[^_]ËWE؉<$RE&d$,[^_]f¸HpFEIEE?EL$EMD$ $K'HDuF4$P>UWVS~5* $$Ee M1ɋU xt ЋxEt&vtn<%uv%[ tWDiDv%1 t-DBtStst Rut&vEufMDž`Džl txE|nDžhE\(vEu|G|Wu%uh|1 fvTGDyu<.DžpxtRu`t`$>hth$&E+x E$|$>tEMe3 % $[^_]Í&(Mu$Hj\HL$D$$}lPUluEu9pMpNU;hNhhUu:EUփR PUxUuHMbMu$R[-Džh` `9l΋lv9uP$RۋUu$踈tlHMlu vDydDžp1fvTGDyu鉕pdEvʉMDH'X1}vvDADOulXEvut d1ɀzEt&vut dR۹SvҋxUDžhp]|D$ \T$D$1ҋdD$x$VttpD$d $HD$ D$D$+pHPt&Iu5|D$ \T$D$Ud $DD$uttpD$d $HD$ D$D$~pHIulP@ D$T$<$elH҉t<l:ttTD$PHD$ D$D$ $}EЋH0VFUȉPỦPUЉP UԉPU؉PU܉PUPF0|$D$$MD$D$$MDž$fɃы@=Vt |<L>0uL>0뎍dDžMe3 H$l[^_]Í&[}tDžt~t$\Nj$\tht|D$|$$3|tIuG<$PuF4$PtHtu G<$Pt t tDžF4$PWG<$PАt&Ud$]u~ u4$Ft'҉t)D$dt$$gH1ҋ]uЉ]ÐP$R̐t&UVS}d d$ET$D$ D$x4$gM4$[ƒx  Rud$[^]É'UWVSN} $U e M1ɅҋEEtu9D$!$cq1Ue3$[^_]Ðt&$HCxp Gd.#EE@ B@WEDžhAP8t @W Džpۤ|Džl`dx1%_vyϋh9M|E+^[ltu F4$P:EfEh$yjPBV$[vf. Džlt h'v%"Eh$\i‹\tWAۃSSQ?`vB+r D$|D$L$ t$$MؐEt҉2  l 1/v>(11xvQ*mQDž vAЉ  ɉȺgfff); :t&QЉ  gfff )9 ΃yD$$nv␍t&L%Dž%DžtDž%1Dž Džx9M);}m|+TdЉ|E|\*[\ |+EP xt? tx9)tjXtxu` t2ttBBtIƒ9~|usR9@|ꋅ+4+4 HtD$T$X\$wSX)9‹\G׋f@ 9ǍvR~퉵pt %D B$POdE||\X\|)ȉEP щOcKfp[ Nθv(vЅ~)uލ@v $)D$m|ltppT$X$DX EDžlDžhHt& t&9T$$~Vps\$q\PBTux `D$T$ B\D$Ѓ$C҉\, R t@9ЉHЉB@T<zB DžDžtDž9F\$;Z苍\ IfG w fT$Dd\T$D$ U$XݝHD$D$A݅HX\$ T$tD$x$Jt$O‰\x%tt&<xvuG 44RE9|鋽xB o+@ tRDžlP$R\pNt$2mDžldB\$P\Dž؍HD$$]DžB\$P\<랋B\$P\wT$ D$D$D$X\D$D$@E$6X\ݝH <\݅H)B\$PDž\A $PWt?D$\$[Dž\`R\$D$ D$D$5‹\K@ B\$P\xoQ:Dž\L- $Rt&US0e d$EPBWu d$[]ÐU $T$\d$[]Ív'Ud$ȉ]u}ƋM dÄ }twL$$ct'tJt&]u}]Ív|$$\uǍD$$Mt뭍t&P$R멍vD$E|$ L$D$$_]u}]UWVSd $TEUEMUeE1҉|EEU $T$\EU "UM M9MP U*EUE AEEUMEgEu9t-PRTU@UE t҉9uEM9MdMU$EUORwEt҉Et҉*Et҉Ma1Ue3$[^_]ÍvEP$R9uJU9UUvX&9}uCv9uv;MU $QSEt҉uɋEP$R뻍vu}}S}}<E+EMD$E+EUD$E $EUD$D$$'-@@WE(D$ED$ L$D$4$&*U҉UE9E EMɉp&yExEUtU+P E+EЋx$tNpH ~U1f4@92RUuUMpUPA $PB&MEEvMA $P1||n|E9Es#EUM&R?9ʍ@ErEEE~v}2}M9M}+}uÍME}xtufUT$ D$D$!D$<$T<$=MU+Q U‹t$xFLUÄtEҍI@Euv;uwUEUt&EP$R&EP$RxV.ExE UtULE+P E+E)‹t$xiK*E@ |$D$E$:}t&U+UET$U+UT$U $UE$RHUE+P ;PEt҉utUu B$PEUU4j|u}EEE EP$RA@ UUET$$5DUEP$RU"A1,E/|"E| $3EEM ʉU2D$UT$$a/ZF4$PLF4$Pvp&A $P35D$$$>Q닍t&US[W d$EjT$ U T$PT$@ $"d$[]UVS_[ d$E$!1t+ED$ E D$FD$F $!҉td$ [^]ÍV4$EREd$ [^]ÐUEw r]Ð=ts1]Ív t&tރ t1萍t&v1ԐUSZG Mv&`BBu=M[]Ít&'`븐&UZ E=w8%]'`@Ít&`]@Í&'UbZj E=v`BtB ]Ð%'`Ðt&USPY d$E$EЍd$[]ÍUY E=v`BtB ]Ð%'`Ðt&USXw d$E$ZWЍd$[]ÍUSXG d$܋E=1 vu=" f=U=AN=+=& =$<+ك}f=s!=$n=$3=$=$=$c=$&=$t&$(VEEEt&=2=,t&=2H =2B =2RA=2+=2yك}=e=1<t&2= ) = &#===ك|O&=l$'=|!$=w!#=u!t[ك~fd$$[]Ð=`!E=_!=U!I =t=Aك}뫍v=t=eeY=^V =[=W&Q=X2}='2<t& ="2 = 2tf=1&ك}=0J =-ZH=.2=/\ك}=i!%~=d!q =b!+wكn=y2=t% =37g=r=sك,}t&=Jh=Pt& =w  =xvكh}v=2e=]2t& =Z2hZ=[2D=\2كh=K%=F =C=D"=Eك}t&=$<=q$lt&=n$=o$;=p$kك}=%05=0 ='t='&ك|mt&=o=M=trY==كp}=80t='0t&G=(0=)0ك8~ك@~ك }=$=$tj==$tR=$;كك$}}=$t=$t&rO=$t=$ك}Aك}6=y!A=z!={!ك}ك|=L=i=zك(~ك}ك}ك}ك}ك}=r@&ك}mt&ك}]=! =~!"fك|-=pw=l=jtlك}t&ك$~='j=,&كx݃X~ك4}كx}=bfp= Z=!كD~iك}]=i$ =!ك|5=s$ =}$=~$ك|==S!=T!~݃h~vكX}=Rz=S=T>ك|t&ك}u=p!r=q!=r!fك`}Eك}:ك}/ك\}$ك}=n!w=k!=l!=m!&=2=2D=2=2Hvك~ك}ك8}wك|}l= =2Hr==vك}%=|={*=|=%=:=t#=t!=`ك}ك0}كt}=T=I=cv=,t8s=  =*g=+كd}!ك}=S2t4=)2=Q2t!=R2ك@}كD}ك<}=PB=M=NS=O5=Z!t0=W!tCvr3=X!t!=Y!݃`~Q݃~F݃~;݃p~0݃x~%=_=f!Q=g!=h!=E =D uP=$tE2=$=$L'&==$ك(}q=:0?A=1=1t&=Ht&v=I=J&=!= =(tr3=)t!=*rكH~ك~ك0~ك~=_2tr(=22=2'fك}mك}b=$=$=$ك~%ك,~ك}=$2=%2@=&2v=2]t&=2t=2`ك}ك}ك}=v=wt=xك~i= `= = 5t&=2t!r4=3t"=@&ك4~كL~ك ~=2tr3=2t!=2|ك}ك}ك}ك}=$=$=$)]t&="0=!0U= = A= =U2t r3=V2t!=W2كT}كL}كP}كH}=.tr3=/t!=0mك }ك<~ك}ك ~=\!tr3=]!t!=^!&ك~sكl}hك}]ك|R݃P~G="=#$===F =G f==b=#0=$0m=j$=k$Rt&USEw d$E$ Ѝd$[]Ð&UE=t;v!=) v:=_ t+=0t$=/ t1]Ð v3=t =u萍t&]Ð=( s v1fsۍ@v1봍&UE E=w8%]'`@Ít&`]@Í&'UBEJ E=w8%]'`@Ít&`]@Í&'US D Mv&`Bu=M[]Ðt&'`븐&USCg Mv&`BBu=M[]Ít&'`븐&UC E=w8%]'`@Í&`]@ÐUd$؉]uBÎ ҉}Ɖ׸t%T$4$"t $u U1u]u}]ÍP|$4$D$?]u}]Í'Ud$؉]}GB ; uu]u}]ÐT$ $T$o_T$Pƿtʼn$ NjuF4$P륍'Ud$؉]}An Puɉti<6ƋPD$4$ w1]u}]ÐP4$D$>!Ɖ|$$0;t̉|$4$P+~$PtzvUWVSA $4HEu DELPT$ D$eE1~D$dT$ 4$D$* $ D$HD$$LTt$$9D$t$<$&t$$9DD$t$$Qt$T$b9toPP @ t t tt$$9Tt$$92Ee3u{$[^_]ËG<$P농~D$XD$$uG<$P륋LD$ D$H4$D$^=tlUd$]E>Ù Љu}jƉUԉuj\$(UD$ T$ D$D$t$$҉tz]u}]Ðt&]$UԉƉtrƉTi$ƉTQt&1]u}]ÐW<$ERE]u}]Ít&XMԉ $gƉX1륍vMԉ $EƉ\1냐~1$`3vUWVS^= d$čkD$D$D$ lD$~$.$k8IH jMM䍓jN MM䍓]$A4N MMAF P@`~t$D$<$"xV:dtGD$<$~D$x*$tD$<$~D$fd$<[^_]Í&jE%fu F4$Pt&ǃ`d$<[^_]Í'Ud$ȉT$$]}|;3 NjEuD$Ɖ‰$jt҉uVE4$RE]u}] UWVS; d$E̋EU܅tUB@W }EU܋D$$;%E܋ỦD$$D$1NjE܅EE}܋E $ED$ ŰET$D$$EMt. 9ut#‹E$)@~,` ɉ 7`PBWP1F EȋVNUFUEЋFM5E؋UE'ŰM$L$EEЉM$}‹M}ytttE؅tMt9U `;x@ 44$P+7D$|$$ 1Uċ}uUċB$P}܋UtUEԅtUԋUtVtu G<$Pd$\[^_]Ív; N~D$$1$-ȍB$P럐t&}EE1BB$PMfB$PVfE܉$mE}EtWU.`QE $RE}t/E; t$PUĉD$ET$$4jutJuuU; E̋U$E_4 u؍~$?)$Nj~<$D$#$EE]$u u"uV}DEMB;t;D$$U$m+UB1$PvE܋ỦD$$1&E UMOt&d uMU; @Uȉu؉$UED$$*FE$#t$y~$Eu1uuU؉$b@D$ ED$D$$F4$1PUẺT$UD$$EU * O UL։U4$U$i&UEԉ$D$ED$ ẺD$E܉UD$D$UƋF4$PF4$Pt&Ed҉UdBu`aU4$w@UED$D$0$UB$P#HEỦD$ET$$U E dB$P:$UƋUVU$E${~(xD$>B$D$(UU5 }D$ D$UT$1$-"SdEe}1|$4$gE&UWVS~15 d$E܋@U؋Uҋ@.R@ ~u]@p E"tPD$$LeD$D$$-$?BD$$7PD$D$$(ED$$TD$D$$,ID$$XiD$D$$10CLD$$;\D$D$$4UD$$`D$D$$8RD$$dmD$D$$5<Go@m$ND$=h@mXD$$lo$ol$fD$po@m$D$ttso@m$tD$ixtGo@m$|D$=|tǃhI&]u}1]ÐF4$PfuՋF4$P1'US` d$@mD$E$d$[]ÍUd$؉]uΟ Ƌ}D$׉4$wtJt1]u}]Ð4$D$Ftt-]u}1]Ë]u}]Í4$D$tхt 1녍v4$D$tt 1Z4$D$tt 124$D$Ut 14$D$Z)t 14$D$.t 14$D$t  14$D$t  1V4$D$yt  1*4$D$~Mt  14$l*@D$D$$$F4$P&Ud$؉]uw. ƋL}D$׉4$tJt1]u}]ÐP4$D$tt-]u}1]Ë]u}]ÍT4$D$^tхt 1녍vX4$D$6tt 1Z\4$D$tt 12`4$D$Ut 14$2@D$ D$$$YF4$P Ud$؉]u}֋PÆ BTuO$Gt,@D$D$$tE]u}]Ív$Ht>1]u}]u䐍t&F4$fP]u}]Ít&'Ud$؉]uþ ; }Ɖt)tD$E$7]u}1]f1鍶UWVSc d$ԅUEtEM $t>M~71fJ 9}~#DMU܉$хUu܋t 1ҍd$,[^_]ËB$P1 Ud$ȉ]}þ uu ]u}]Í&tD$D$$tƍ h!D$U䍃4$D$UWD T$UD$4$UWD T$UD$4$nUtf hG !tWD$U䍃4$D$*Ut"B$Pt&u B$Pt1|F4$1PlfB$PfB$PfB$PCfUWVS՗ d$u>1t&F$mD$U؍Y<$D$:U' 8 F$%D$U؍A<$D$U u4B$Pd$L[^_]Ë܅v &d$L[^_]Ðt&D$D$$:t̋F  D$$t&t 1d$L[^_]ËD$D$$½PF$UtD$U؍ƒ<$D$U k FaD$U؍ <$D$Ut u F $D$|U؉D$<$9U% B$PD$D$$貼@FD  ! ǃifD$D$$bFFD$U؍<$D$mUY  F$D$D$D$$ʻX hFD$:U؉D$<$UL hF~\D$Et&D$D$$*F$ D$U؍<$D$2U0}FD$D$D$$蒺 F$%sD$F\t&D$D$t&D$D$뎋D$D$$ F$D$U؍ƒ<$D$UFEtEE$E1ɍ}܉Eωщ=ED$U؉Mԉ$[1MԋU؍v9}Bq | wD,t&D$D$$F$D$U؍<$D$UF$<D$U؍<$D$UF $AD$*f D$D$$F$D$U؍$t<$D$U hFD$U؍<$D$U{F }[D$U؍<$D$UnF$D$U؍(<$D$9U%F${D$1f D$D$$蚶(F$-{D$U؍F<$D$U_F$2D$U؉D$<$YUEF T$8t&$D$D$$躵HVVXD T$U؉D$<$U5FoVD$D$($2 hF2D$D$v ]u}]Ëu G<$PF4$1Pt&GU<$PU0t&GU<$PUYt&Ud$ȋU]G ҉u}u ]u}]ÍxUD$D$$'NjUt2D Ut$D$<$7UtotLB$tgD$<$FD$t8LF4$P>vFU4$PU룍&u F4$Pt1G<$1PfUd$ȉ}}]uø u ]u}]ÍhD$D$$tNj$D$U䍃Q4$D$UG$9D$U䍃4$D$Ut~tc hGetsD$U䍃X4$D$nUt>B$PB$P^fB$P뒐t&u B$Pt1F4$1Pv'UWVSn% d$ԋu(1>F$D$U䍃Y<$D$UlF$z\D$U䍃A<$D$GU$Ud$,[^_]fpD$D$$§tϋF$YD$U䍃<$D$UF$D$U䍃\<$D$Ute@F 8tVD$U䍃<$D$AUt!mB$P_t&u B$Pte1fB$PefB$Pd$,[^_]Ít&B$PfB$P4f d$,[^_]ËG<$1POt&UWVSõ~ d$ԋu>1t&F$MD$U䍃Y<$D$U(F$D$U䍃A<$D$U u4B$Pd$,[^_]ËXv &d$,[^_]Ðt&D$D$$t̋V\D T$UD$<$,U(  FD$UD$<$U # @F D$U䍃<$D$U  hFIGD$\t&UD$<$IUE B$PD$D$$£pV\D T$UD$<$U + hF}D$tD$D$$* hF*(D$kD$D$$ڢF$mD$Ft&D$D$$芢8F$D$U䍃Q<$D$U D FGED$U䍃 <$D$LUH  F D$D$$ʡxF$]D$U䍃s<$D$U  hFD$U䍃<$D$U  F $6D$x&D$D$$ hFD$U䍃k<$D$U Ft&D$D$$bF$cD$U䍃Q<$D$jUfl F$D$U䍃<$D$!Us @F D$U䍃<$D$Ug F@D$;vD$D$$2`DF20T$D$D$$F$uD$U䍃<$D$UF$,D$U䍃<$D$UF $tUD$D$D$$>F1d$,[^_]Ít&D$D$$蚝HF$-tD$U䍃<$D$UHF$VD$U䍃<$D$]UYF $ D$D$D$$躜h@FD$U䍃<$D$UR~FnlD$UD$<$sUoF D$D$t&D$D$$қ{vD$D$$袛PF$5D$U䍃<$D$U@FYWD$D$D$$ F$ D$U䍃{<$D$U$F$TD$U䍃<$D$U+@F xvD$/&D$D$$"Vd D T$UD$<$0U,`DFD$U䍃<$D$UF $εD$Mt&D$D$$B@FB@D$U䍃<$D$GUC@FD$t&D$D$$袘PF$5D$U䍃<$D$UF$ZD$KvD$D$3t&D$D$Ct&D$D$G<$1Pt&B$PvB$PfB$PbfB$PfB$PfB$P B$PB$P]B$PKB$P&B$PB$PfB$PfB$PfDB$PfLB$Pf'B$PfTB$PfB$PfB$PfB$PfaB$PfbB$Pf}B$PfB$PfB$PfB$Pft&'Ud$ȉ]unn }u]u}]Í&YD$D$ D$D$$t$tǍ@m<$D$D$֔xD$D$4$訦l„4$D$ȄD$Hl<$D$@D$p$p<$D$iD$Lt<$D$pD$(x<$D$|D$|<$D$D$<$D$]D$輓p<$D$D$蘓L<$D$D$t(<$D$D$P<$D$D$,<$D$D$<$D$D$<$D$D$t<$D$D$蜒P<$D$āD$x,<$D$ED$T<$D$ʁD$0<$D$ρD$ <$D$ՁD$<$D$߁D$đx<$D$D$蠑T<$D$D$|0<$D$D$X <$D$D$4<$D$D$<$D$D$<$D$D$Ȑ|<$D$D$褐X<$D$D$耐4<$D$ D$\<$D$(D$8<$D$/D$<$D$5D$<$D$=D$̏<$D$DD$訏\<$D$JD$脏8<$D$OD$`<$D$XD$<<$D$eD$<$D$kD$ <$D$sD$Ў<$D$D$謎`<$D$&D$舎<<$D$ D$d<$D$xD$@ <$D$D$$<$D$D$(<$D$D$ԍ,<$D$D$谍d0<$D$D$茍@L<$D$D$hP<$D$D$DT<$D$D$ X<$D$D$\<$D$D$،`<$D$D$贌hd<$D$D$萌Dh<$D$D$l l<$D$‚D$Hp<$D$D$$t<$D$ȂD$x<$D$΂D$܋<$D$ D$踋l<$D$D$蔋H<$D$ՂD$p$<$D$&D$L<$D$+D$(<$D$ނD$<$D$D$<$D$D$輊p<$D$D$蘊L<$D$D$t(<$D$D$P<$D$D$,<$D$D$<$D$D$<$D$ D$t<$D$D$蜉P<$D$D$x,<$D$ND$T <$D$%D$0<$D$*D$ <$D$/D$@<$D$8D$ĈxD<$D$5D$蠈TH<$D$;D$|0L<$D$>D$X P<$D$BD$4T<$D$ED$X<$D$ID$\<$D$LD$ȇ|`<$D$UD$複Xd<$D$RD$耇4h<$D$ND$\l<$D$XD$8p<$D$fD$t<$D$D$x<$D$tD$̆|<$D$|D$訆_t&'Ud$uu]Û_ t)ED$$趜t0U P]u]ÍTD$$&]u1]fUd$$]ut+_ }UԉǍ\t$6t$<$RtEU$u` R<$t$E1UD$ET$$`Uԉ1]u}]Ít&tE]u}]ÍvxD$$$]u}]Ít&F4$P]u}]Ðt&t$<$\tEU$fu F4$PEfF4$Pv'Ud$؉uu]}Ø] } t\t/ED$$謚t0x]u}]ÍȇD$$]u}1]ÍՍ&US`] d$ED$$2tUU PUPUP d$[]Ð&US\ d$ED$$t$UPU PUP UPUPd$[]Ít&'Ud$؉uu]}X\ } t\t/ED$ $lt 0xUP]u}]ÍD$$ַ]u}1]ÍՍ&Ud$uu][ t1E D$$t p]u]Í&DD$$N]u1]Ív'USW[ d$E D$$rt UPd$[]ÍvUS`[ d$ED$$2tUPU PUP d$[]Í&USZ d$ED$$td$[]É'Ud$uu ]{Z u)hD$$/1]u]ÍvED$ $mtUPpUPUP]u]ÍUd$uu ]4Y u)D$$蟵1]u]ÍvED$ $ݖtUPpUPUP]u]ÍUd$؉uu]}衿XY } tlt?ED$ $ltpxUPUP]u}]ÍvD$$ƴ]u}1]ÍԄՍ&Ud$ȉuu]}øX } UtOҍtNEUD$ $踕UtGpxP UPUP]u}]ÍvD$$ 1]u}]ÍȈՍ'Ud$ȉuu]}AW } UtOҍtNEUD$ $UtGpxP UPUP]u}]ÍdvD$$L1]u}]Í<Ս'Ud$uu]脽;W t9ED$ $VtpU PUP]u]ÍvD$$趲]u1]fUd$uu]ûV t9ED$ $֓t pU PUP]u]ÍvD$$6]u1]fUd$uu]脼;V t9ED$ $Vt pU PUP]u]ÍvD$$趱]u1]fUVSU d$utME$D$ $ڒt- pU PUP UPUPUPU Pd$[^]ÐԉD$$&d$1[^]Ít&Ud$uu]t+U tIED$ $Ft! pU PUP UPUP]u]Í&D$$薰]u1]fUSçT d$ED$ $‘t UPU PUPd$[]Í&Ud$uu]蔺KT tAED$ $ftpU PUPUP]u]Ðt&D$$辯]u1]Ív'Ud$uu]ûS tAED$ $֐tpU PUPUP]u]Ðt&@D$$.]u1]Ív'US耹7S d$ED$ $RtUPU PUPUPd$[]ÐUd$ȉuu]}!R } UtOҍtNEUD$ $؏UtpxP UPUP]u}]ÍvD$$,]u}1]ÍdՍ'Ud$؉uu]}aR } tlt?ED$ $,tpxUPUP]u}]ÍvD$$膭]u}1]ÍЊՍ&Ud$؉]uǷ~Q u}} tKtAED$ $膎tpxUPUP]u}]Ðt&|$4$D EUԉ$2u G<$PEm|$4$~MU؉ $G<$Pt&UWVS螔U. d$EЉUȉt$$[EЉt$$t~t9@@WuE@ D$PD$$$tgd$\[^_]Í&VEUԉD$$vEtMԅU܉1Ủ&E܍F9}ԍv~oA U$ỦMMtщ΋kF4$Pd$\[^_]ÐD$$$d$\[^_]É΋EЍ$t$ EUЍ$t$EUЍ$t$Œt>EЉt$$|@@W@ D$^#t&UЉt$$|REU$O+5F4$P'fF4$PfEЉt$$1|EU$F4$PVEUԉD$$tEUԅ~KU܉1ỦE܍F9}ԍv~%A U$ỦMMtщ΋u F4$PEUЉD$ED$ED$EĉT$ $5Uȉ1 Ud$$]u* }UԉǍQt$֊t$<$zEU$)<$t$t$<$zEU$umfX<$t$,t$<$Hzt=@@W@ D$D$$$Dct&tE]u}]Ív D$$$V]u}]Ít&F4$P]u}]Ðt&T뮋F4$Pf떋VEUЉD$$KrEP}Ѕ~aU܉1Ủ&E܍F9}Ѝv~5A U$ỦM MtщfF4$P΋u F4$PEUȉD$ ED$ET$$tUԉ1Ud$]u藎N( ; }ƉEh4$D$xt&E$R]u}]Ít&l4$D$xn4$T$UU-En4$T$U蹇U^E4$T$U蒇UE1D$EUD$ET$ $Q)ft4$D$wt&]u}]Í1]u}]Ívp4$D$wttL4$T$UІUT$4$vt@@W&@ D$D$$Mĉ$_Mċ@A $P4t&F4$T$U;U&T$4$TvEU܉$ȉM?Mu<UE܉T$$U$D$$$ft&T$4$ubEU$ȉMMA $P&T$4$tu EU$ȉM_MfA $PX&T$4$uEU܉$ȉMMEE/t&4$Pf@D$|t&AUMĉEԉT$$xmE̋MUԅ~YU܉}1ωUЉfE܍vA9uԍI~0G U$UЉMMtщP5}ȋt/EỦD$$-A $P A $PƋA $Pt&t&'US谉g# d$ED$$`tUPU Pd$[]Í'US`# d$ED$$2`tUPU Pd$[]Í'US" d$ED$$_tUPU Pd$[]Í'Ud$uu]贈k" t9ED$$_tpU PUP]u]ÍvD$$}]u1]fUS@! d$ED$$_tUPU PUPd$[]Í&Ud$uu]Û! tIED$$^t!pU PUP UPUP]u]Í&̘D$$}]u1]fUd$uu]T ! tIED$$&^t!pU PUP UPUP]u]Í&D$$v|]u1]fUSІÇ d$ED$$]tUPU PUPd$[]Í&Ud$uu]t+ tAED$$F]tpU PUPUP]u]Ðt&D$${]u1]Ív'USç d$ED$$\tUPU PUPUPd$[]ÐUS蠅W d$ED$$r\t$ UPU PUP UPUPd$[]Ít&'US@ d$ED$$\t$ UPU PUP UPUPd$[]Ít&'Ud$uu]ԄË tIED$$[t! pU PUP UPUP]u]Í&8D$$y]u1]fUd$uu]D tIED$$[t! pU PUP UPUP]u]Í&*D$$fy]u1]fUd$uu]贃k tIED$$Zt! pU PUP UPUP]u]Í&`D$$x]u1]fUd$؉uu]}! } t|tOE D$$Yt$pxUP UPUPUP]u}]Í&D$$6x]u}1]ÍՍ&US耂7 d$ED$$RYt$UPU PUP UPUPd$[]Ít&'Ud$ȉuu]} } U}tPҍtLEUD$$XUtpxP UPUP]u}]ÐD$$w]u}1]Íș Ud$uu ]T  tAED$$&XtUPpUPUP]u]Ðt&r]u}]Ít&1]u}]ÍvG<$P]u}]Ðt&떋G<$Pf4$D$fP\4$|$u|$4$fEU؉$zt4$|$uN|$4$e@@W@ D$D$$$NvG<$PG4$D$ebt]F4$|$ ueE1U$T$ UT$UT$+IM@04$D$Let}k4$|$tJ|$4$d@@W@ D$ܝD$$$Mtt&t`4$D$dJk4$|$s|$4$ d@@W(@ D$@D$$$M|$4$cMUԉ $u G<$PE\G<$PԜ4$D$cXxQ4$|$rS|$4$c EU؉$u G<$P 4$|$r|$4$bMUԉ $kru G<$PF4$|$Er|$4$abjEU܉$OGu G<$PEUD$ED$ E܉D$EԉD$E؉T$$;G<$P ț WMUL$$ZE}1ɉEĉuEԉΉEvMċEԍvA9uMrG U$UytpGUET$$3ZEP}1ɉEĉuE؉ΉEt&MċE؍vA9uMG U$UtGUEĉT$$YE}1EԉEfEԍvA9učIG U$UMMtu\4$|$,p|$4$H`Q@@W @ D$D$$$@IEMD$ED$EL$ $,?UOEMD$ $XE1ɍU؉uU)G MU $菿UċE؉Dv;u|ҋuu G<$PF4$|$oP|$4$0_9MUԉ $ u G<$PEUĉD$ED$ ED$EԉD$$U4О4$D$#_s4$|$`n!E4$|$?n|$4$[^d@@Wc@ D$\D$$$SG&tAu4$|$m|$4$]@@W@ D$D$$$F4$D$]HQ4$|$9m#|$4$U]^EUԉ$C;u G<$P4$|$l|$4$\MU܉ $u G<$P4$|$l|$4$\@@WC@ D$8D$$$Ej8G<$PHla4$D$\+4$|$k|$4$[EU؉$ػu G<$P4$|$rk|$4$[@@Wu1@ D$D$$$D]xWMUL$$TE21ɍE܉uE;u}6G U$UMċE܉DvЍHuu G<$P4$|$j8|$4$Z@@W@ D$tD$$$Cp4$D$Z`4$|$j|$4$Z(EU܉$ u G<$P4$|$i|$4$Y@@Wu1@ D$D$$$BԡWMUL$$JREg1ɍE؉uE;u}6G U$U19MċE؉DvЍ,Euu G<$P4$|$h|$4$X@@W@ D$TD$$$A4$D$XP{4$|$8h|$4$TX]EU؉$B:u G<$P4$|$gE4$|$g|$4$W@@Wu1@ D$ܢD$$$@GUEĉT$$^P|E1E;uMG U$UMDMIEԉDvɍ X4$D$W"4$|$fE4$|$fME4$|$fE1UD$T$E܋UD$T$EԋU$T$ KgGUEĉT$$=O[E1E,G U$UM:M/E؉Dv;u|ϋuGM<$PMEUD$ED$ED$EԉD$E܉L$ T$$l@|$4$UMU؉ $諵u G<$PE|$4$sU|EU܉$aY}G<$Po|$4$(U1MUԉ $G<$P4$D$IUh4$ED$d@U4$T$T@@W@ D$4D$$$=g|$4$ST\MU܉ $C;'G<$PuGM<$PMEL$D$ED$ED$ E܉D$E؉$a]OEMD$ $LE1ɍU؉uU;uG MU $zUE؉Dv̍h4$D$SX 4$|$b |$4$S @@W@ D$xD$$$<uu G<$P4$|$b|$4$R@@W@ D$D$$$;hOEMD$ $+KEH1ɍU؉uU;uyG MU $UċE؉Dv̋OEMD$ $JE\EEUME}uE9EUMB <; Eĉ<$D$WaiUĉ<$T$pQHMU܉ $`eu F4$PE<$D$`=U<$T$Q MU؉ $e0u F4$Pp<$D$@Q E<$D$`)EE<$D$b`EE<$D$D`IU<$T$]P@@WuQ@ D$}EM1ɍEԉuE;u}6G U$U臕MċEԉDvЍD+uu G<$P4$|$T(E1UD$T$UT$MċUE܉T$ L$$HC4$D$D4$|$.T|$4$JDSMUԉ $:2u G<$P4$|$SE4$|$SE1UD$T$E؋UD$T$EԋU$T$ 't4$D$C:4$|$2S|$4$NCW@@W@ D$D$$$F,}$V@D$D$$}$KN}ܤuu G<$P4$|$XRR|$4$tB}@@W@ D$D$$$l+?WML$Uĉ$; E1E;u}9G U$UMME؉Dv͍HuGM<$PMEL$D$ED$UEMD$ T$ $mEOEM $D$S:qU1U;u}9G U$UM=MBE؉Dv͍QuGM<$PMEUĉD$ED$ ED$L$$uGM<$PME $D$ ED$ED$y1|$4$@EU؉$T~u G<$PE|$4$N@WMU܉ $>6u G<$PE@|$4$@EU؉$G<$PU<$T$?t{MUЉ $謟 F4$PU<$T$p?t;MUԉ $dF4$P}7}t&+tD$$}$J uFM4$PMEL$D$E؉D$E܉D$ EЉD$Eԉ$l}}GUEĉT$$n7E1E;uG U$UM4SMYE܉DvɍЧh4$D$>2F4$|$Mte|$4$=MU܉ $u G<$PED$ ED$ED$E܉$34$D$=tZEMD$EL$$6xuGM<$PME $D$ ED$ED$=B<4$D$v=tEMD$EL$$`84$D$9=tEMD$EL$$74$P@D$(D$$$%n&'US@R d$E D$$)t UPd$[]ÍvUd$uu]Që t1E D$$(t p]u]Í&TD$$.G]u1]Ív'USQ7 d$E D$$R(t UPd$[]ÍvUS@Q d$E D$$(t UPd$[]ÍvUWVSPõ d$}puE؋xE܋tE51D؉4$D$=;t1; /p4$D$ ;CK4$T$UFJUs4$T$_:@@WFU EĉT$$3EUą'EE1ΉvEF9}čvA U $UMMt͉Fi@ ỦD$ |UЍpUԋD̉D$fD$$1$"d$L[^_]Ít&x4$D$9t&1d$L[^_]Ívt4$D$9tمt4$T$UHU4$T$8t@@Wn@ D$ܨt&4$|$H4$|$8HE U$萘uMU ET$$Et&@ D$|D$$$g!F14$PD$$$~Czދ|4$D$N84$|$Gb4$|$7M@@WG@ D$t3FU EĉT$$C0E!}ąEE1ΉvEF9}čvA U $UMMt͉΋E UD$$KO4$FJl@D$Щ_DD$$1$B ΋E UD$$F4$Pj륋FU EĉT$$/EMą~fEE1ΉEF9}čv~AA U $UMMtщF4$PTF4$PI΋tE UD$$=F4$PܐU1҉d$ȉ}}]u_K t|YW?wNwFE R$T$U"ƋUt@T$D$$\>]u}]Ív1!]u}]f ϐU1҉d$ȉ}}]uJv t|YW?wNwFE R$T$Uy!ƋUt@T$D$$>]u}]Ív1]u}]fkϐUVS/J d$@D$T$$3tD$$#td$1[^]Ít&F4$Pd$1[^]Í'Ud$D$D$]}IN u֋RT$ @ D$ED$$v ¸x]u}]Ít$u]u}1]fU1뷍v'Ud$ȉ]EHé Eu}U䍻tst"jXt&oXt]u}]ÍvpU$E]u}]Í&Eu}]]&'UWVS,H $eU1ҋE vLVD$D$T$ $1t&Ue3$l[^_]Ít&␍t&~ukEFՂf}tD‰D$ L$D$D$,4$򋅴[v먍t렍\똍I됍#눍8뀍dut&et&oUt&}EF UV }EFU~V1 v97TD$E$u1Sv:F$*뼋F$6%t&'Ud$؉$]uEK }3t D$<$]u}]Ív'UWVSNE d$EU܋BU؋UM؋B $D$(EU؅~ZE1vU܋MBtf>uFpf>v~tEeUԉDE09}MU܋AMԉD$B D$ BD$ $D$ƋE܉D$E$*u1d$L[^_]ÐFU܉$E7t݋EPFtˋMQT$V T$ VT$D$$@?t&UWVSCã d$E܋@2EPDp_E"W$U!HMT9Q}E؅<8,M܋tJ1MԅED$\$U UxDUԉT$MUD$ D$T$ $T@d$\[^_]ÍvU7EB bRt r7EM9 Q9WUT9u@ED9D$& $61&M܋1 J8E}1UԅD$D$<$8tg҉u\V4$EREd$\[^_]fuB7Et&pMEL$$Nd$\[^_]Ðt&D$D$<$(n&ֹ JD$ $z51똍E}t&'MD$ $A51\f}䪪*v1JU$RD$tۉ$MMM؉ljU19UܪẺU܋E}ĉufxI9}\uݍ@\Iyu005fAcI빐UMD$T$ $F11|UD$4$D$a.t&D$$N5199E؉jU &?y9w)D$T$$M0 ED$D$4$-EMuUM$J‹EU$JEUM~c}1׍D7U܉D$D7D$D7D$7 $MD$T$ D$D$vx4M 9u}ЋU@BM$PM,F4$PM0}ĉȋu)\uȋF4$P11vUщd$]}uru> fAf0?Ef au1UD@f8Eux0@fx0P1WD$ET$ t$$[:]u}]Íf~00V01두t&f0f$toW$T$묍&Nf~0VuMƋMt0AEA'v@$]41GMƋMtQUAM|EMtqAu@OP U܋@ʉE䍃MU܋M؉T$ UL$T$D$$81t&'UщWVS< d$Ef&v7ҍ9T$D$$EE؍d$l[^_]Ív0fM1yMuԋQT$ V T$VT$$4E؋E؍d$l[^_]Í&MԋEQEtuԋFuI}ԋWfzBr9EE0EEt&~ffGWM@QT$$EtgO'1E1ωE4v8DUM܉U0vDE;pEPE/uEE؍d$l[^_]ËQt&I*ytMԋEQt}ԋEW0tWRf"wMҋt}O}ԉL$O L$OL$ D$T$4$;EW`EEЋu9uUԋBt8f"ʋU܋ 8EEMMU0RT$V T$VL$M؉T$ D$ $Es&t&QuMԋFD$$+E]}GD$EԋP$E3Uԃz~EE3MuԋU؋vuȍ2B@}Bf8PT$ @D$ D$$S E0&yMԋQEz}MԋWT$Q T$ QT$D$$$EfA\uMԍ@VT$$kE }ԃ11't&M0vDE9pEԉPEut&qf=/f=A AMEMx}ԋEW0]EԋPE`DMQMԉT$Q T$QT$ D$t$<$#Et&~u؍WE4$]E؋U؅p}̋U؋GBGBMԃEA9E+MԋuȋQE42f>B}؉}t&UDžSMP xE܋qUĉt$$*Uĉt$T$U؉|$ D$D$$%EM&WEU"MQT$W T$WT$ uD$D$4$$EUM؋BD$F D$FD$D$D$ D$D$ $EVfD@f:<Esu}ԋVT$W T$WD$E؉T$ D$$$Et&Mu܋AD$$q~1҉t&tvtR;|UBD$G D$ GD$D$ $^MW qUĉt$$Uĉt$T$|$ QEPG9vMQT$V T$Vu؉T$ D$D$4$ EPQEL$MԋIf9Au:u5fy<u-xu'Pf:=uzuRf:>u rf>U‹E MԋQfzf =fҍ$T$~VESnVEHXMQT$V T$ VT$D$<$GEUԋB_@:_H:_H:J@:BMuԋ}AD$F D$ FD$|$$E:Rf}fffBD$D$ԬUMԋuBD$A D$ AD$t$$EP2:r:OJ:O E؋MȍTEU܋MUtuЉDEԃEE0U9PMԋEQu}ԋM̋VT$W T$WT$ UЉT$L$$dEpuu:pMI:N`MI:NP)ft)fB79up:WuP:W U293MP:Q#P:Q}}MԋWT$Q T$ QT$D$$EMuԋQT$V T$ VT$D$$TEuVT$Q T$ QT$D$$$EeUBD$ D$D$D$$VE03~1ىUĉ $NjUb-FD$UčG$F$ ~UċEd$l[^_] t&UWVS~.5 d$E܉Uf:uJzu8@D$ D$D$D$$5d$|[^_]Ít&MAEExpP1E1f@R9t f u@E9RuU1ɅE|EEEHEEE1UEMEP9EH4f$f= f|$ D$D$$M}ԅtUԋuЅtDMЋu6A $P1&U܋MB $D$1d$|[^_]1U܋BMD$4$rE̋M1ɍD41B$EL?M܋QMAD0E8}E}7t&Eo~[vv~vWEE9}ċW@f<uMIT0EEUȋM̉DUȃEE눍D41B$Ei\E܋MPAD0E7t&B$P>E}tUE܉$^EMċUDIMċFf8U؍fVUE܉$>t&}t&몋u؅tEIoE6\U܋MBUЉD$ẺD$ EԉT$D$ $?@U$E!M܋FQ@hM܋QT$V T$ VT$D$$&UċMDUt&'UщWVS)c d$ĉE@D$AM܉$m EMtzq~s11MvMԍv09q~YMԉEQt>MDMtNjMԉQT$U$‹Eu&EEd$<[^_]Ðt&UWVS(Ó d$EREu1d$\[^_]Ít&G1xvu?@@tfPtfQPxu@@DfPu߃xvtƐt&tUB4$D$9 EtOIuEΉ}~vEHL$F D$ FD$<$UMD$"MUL$ D$T$$ Dž ~E܋Uԉ|MЉE9SF$E؉‹EVEHKM؃yExUxRt @@Df8PuUUM؋B $D$ EE؅~z1ɉ}ĉ;}}`vEVGỦD~uҋv0ʋ}ȋUMԋBD$G D$ GD$EL$$c}f>OuvM̉OHE>t&UWVS%å d$E؉U܋JB1EE1 vR@9t&f8KuxtixfPtnRE9ʍ@uڃt}MEE=~FjE1d$\[^_]Ðt&Ew&vhE1EUuB4$D$Eu 1d$\[^_]ËM؋AD$E$tڋU܋REEEE1#f(f$M܍v9qM܍vQ‰Ef=KuÃyEPfzPPEC@EȃEԋEMԋPE؉ $U1҉u&v;uDUԋT$$u؋M䍓Ao1ZԭEZd$\1[^_]ËExMąUME؋Q;gŰMЉDUuEPE؃0 6M؋QD$EȉT$$UDUk‹Eu1EEU؋MBUĉD$AD$AD$ED$MЋET$ |$L$$5Jvk‹EXE1|vk‹E6E1ZUBd1M䍓A1UB81A1&UщWVS!Ó d$ĉE@D$AM܉$EMtLA~E11M!vM0vDE9p~MԉEQ:uEEd$<[^_]ÍvUd$ȉ]u}2! zu]u}R]&1t%GD$D$F D$ FD$$]u}]ÐUWVS q $eE1BfvEͫD$҉T$$1fMe3  $[^_]Ít&ʋ̲f@DPBHЋGD$$ 8 w1닍vW@EtWT$V T$ VT$D$$dO&@DJ@D$DDXLlDX$D$D$e‹X8JjD$}$UvP‰X~X@DžDLt(OvDž4 \P$R`P$RG<$P UWVSã $4eE1f,vdFd҉D$T$߫D$D$ D$4$N 4$v 1ɍt&Ue3E$[^_]f8fF@01ɿt&FTЉPPFT9o&Ff8O&N111t&9~R!Ff8 u䉕TPPTÍvFpF&1FNt&'UWVS ì d$Ef=7f1D$D$$d$L[^_]Ðf=tzf= uNjVUҸ~6V1uE֍vF$v0E9}ЍPUuȉD$$1d$L[^_]Ð~vf=-E~M̋FQ@NtM̋Q$T$UT$YǍd$L[^_]Ít&$jEỦD$B$M̋AD$D$E$Ǎd$L[^_]ÍvExF~J1EBtUMĉ<$t$4$O<.UMăE0E9BGE$bESfE̋PF@4OE&M̋FQ@'M̋QD$T$$-VEE̋PF@4G*&Ud$]uW }NjB֋@$1t.~;FfxHPHzt%uE1]u}]ËGUD$$UtҋRMMtAVMEtFW@MtWL$T$V T$VT$UT$ UT$$Z&Pxf=FW@MM!WL$T$V T$VT$UT$ D$$hvVHUWVSÓ d$f= f= f= t\JM ffDv8RT$ D$D$$1d$\[^_]Í&ɋfzfv6G҉D$ T$뢍Rkt&RQt&Uԉ$tEԋPUԋBHH0M1fx0*K EPMMhVuԉT$V T$VT$ D$L$<$Uԉ$}ԋ}ċFD$G$*EW}EEEċUPŰzOM܋G E؋GV@<VM܉T$U؉L$T$ D$$W }E0EFvV $T$U؉T$U܉T$ D$D$t1EE0E;GUGUDVMMu1d$\[^_]ËUԉd$\[^_]}E Uԉz$.t @E}ԉWHztEԋPxtMԋVT$uQ T$Q|$}T$t$ D$<$Bt&}ԋGbD$D$$rd$\1[^_]ËEԋxtUԋBPdJsi TOf8ɍAEHMЋMЅUЋMME|RxEԉPiEVMԍW0Q>MԉQNL$J L$RM܉T$ U؉ $T$D$UBEM9MU؋F$D$Ea1f}̋Gt&}̉W $HEЋULMăEE;A}ԋGP@f= f=IVM $uԋVPV Pt&ŰFD$B D$BD$ $D$D$ D$D$G1G  D$FD$G D$G$zMW$yVT$ W T$WT$$OL$TFD$G$/EuE܉&MvDE0;wEM܋PGD3u1G~Wfz# EV@)ȉT$‰M$~E؋MPG9IU؉uUΉ#Uv0BA9ƉUQEMMu1GO OfyVT$$EGPGf8T\1҉}E0E‰ut&UEBD$E$JJMtuFP9uUE0Vf:TMEM܋Eu1OM܋G Eԋ}f=M f= URU }1ɋ}؉Gf= ffEر0u0f 8f@u эQ9UߍQuЍREE؉Eff=fE1Ofҍ,T$W E1}ԉWEԋPH EԋPM MiVuԉT$V T$VT$ D$L$<$at&EP0UԉMT$‰$M`l&@xs&F$D$EEkPPEMԉkQ`Q E|EԋPkP \EkHpMANL$H L$@D$ T$E܋U$D$MWAM\t&}ԉWEԋPH MԋVT$uQ T$QT$ t$D$<$[NWMEMx1EyVT$W T$WD$}ET$ |$$kXQ&VT$ W T$WT$$yyFD$ G D$GD$$)|FD$G D$G$^AF QMwEMaQH\EMFQxA1VT$W T$WT$ D$UED$$vFD$G D$G$uFuD$ G D$GD$4$ sMԋVT$Q T$ QT$D$$EϋuVD@T$W T$WT$ WM؋uf< L$4$D$YE$‹uЍyM8W}EЍRM}T$ʉMEM h践1pWWHMMVT$W T$ WT$D$ $žEPRVMT$$PEM"Uf:tRR11~eu؉M̉"t&Mv0DE;x}vEPEu1UMM}G}ЅUЋV}܉T$uԋUt$|$ L$T$$a$M̋u뻸DRU؍‰E@Ѝ$1u؍@kWf:G VT$W T$ W}ԉT$D$<$虽R0EG4lUBPTt NtFu@ʉ$M褴MqUL$$TTGfx0GP0C3WR,R -(&&%T$0ղ11zMA@D$ MIMظ01EEEs1,Po]MԉQHEVuԉT$V T$VT$ D$D$<$PEMԉQH7EԋPMԋVT$uQ T$QT$ D$|$4$_RW蕿EԋPHkMԋVT$Q T$QT$ D$D$<$_)Q VT$ W T$WT$$\WVT$W T$ WT$D$$pFD$G D$GD$ D$D$$:FD$W${EP1ɉuE}̉(UvLM̃E0;qM̋UEQu1WHEM1aWx½L1VۤM"MWpj1{NL$O L$OL$ MD$T$ $<*t8+@뾋u؋F}܉D$ uԋEt$|$$z*ҍTR놺 |>/<QQM轼EMQH袼VT$W T$W}T$ D$D$<$8QF6VT$W T$WT$ D$D$$yz/ҍz^t| bX Nv'UWVSÕ d$ĉE܉ЉUM܋Q$T$EE؋Hf9 @E01EuΉutlvuV~{V10Bu)hUvDE9p~SEʍI0PBtAE܉M.MuEEd$<[^_]ÉE tߋUDt&U؃EEB;E~‹JIfqFEQvf< Euu~11M!t&U0Drv9urM؋Q:EuQ&UWVSN d$EЉUBER0EAEMVUUU)ʋMU܋UIRMEԍTft]f=+EEUu܅UЋMBỦD$A D$ AD$EԉD$$蕻ƍd$l[^_]ËrE}~E؋MfpEMDIM؍ESEmu܅_UЋM܋B $D$E|x1fUB 0M؍L0ЋAt+D$DD$1$d$l[^_]ËQEЃHMgEȋMu 1AUȃH$D$E$MtЋQEЃEtU؋EMMtUЋRT$Q T$QD$MȋET$ L$$sUvH9}MЋUAMĉD$B D$BD$ ŰEL$D$$MԉƅMЋA$D$Ept&ME21vTElEUmRU&U؋EЉM:MUЋRT$Q T$QT$ D$D$$觷fQEЃM觶E?U؋EM)UЋRT$Q T$QMȉT$ D$D$ $?zUM؍DRE}EmE}fUd$]u7 ։}NjPF@su1]u}]ÍVRBM$tыV0QEtV`MtWD$T$V T$VT$EUD$T$ $?wfUWVS~5 d$E JE̋Ef8SUEЋMEMԉEf=f=lf=D$D$$#$#uG1d$|[^_]Ít&Uf:S*Et_1Xt&E܉D$ED$E$?ED$$tED$$$xMcET$U$ɸNjU T$UD$ T$g|$$e‹T$Ut$$EU1EU܉D$ET$$P1Myf?IUƉT$$ EBG~YWf:tP0Ẻ}1EMĉ0Qf:t+EMvDE9pċUMT$ $d$|[^_]ÐME̋QJU$T$d$|[^_]fEpM$L$IEEPBMEEEMEupf>tkEUv1҉uu~=EPEU0Dv+E9EыMQ MQvuăEEB;EugыRŰQUt&E$D$MpMUT$A D$A$FIE4$D$mK:F4$P1,EUċMփDEP'GU<$PUEHU$QUEUD$$oẺUBB$PF4$PU ǃHxKUd$D$D$ ]uþ }@pD$D$`$ku]u}]Í$Nj D$<$D$:y1]}u]Ðt&<$D$D$xʋ <$D${D$x|<$D$oXD$īxP<$D$jXD$褫f<$D$AD$耫B<$D$eXD$\h<$D$lD$8<$D$ 8D$<$D$D$8<$D$!D$̪p<$D$~D$訪j<<$D$~D$脪F<$D$D$`"<$D$D$<<$D$FD$<$D$D$t<$D$D$Щl<$D$F~D$謩n<$D$D$舩J<$D$FD$d&<$D$TD$@<$D$ۇD$<$D$D$4<$D$D$Ԩ<$D$D$谨r<$D$D$茨N<$D$.D$h*p<$D$|8D$D<$D$D$ |<$D$D$(<$D$D$ا8$)‰D$U䍃]<$D$螧Ux% B$P4%B1$PvUWVSU d$ċE $u!$EEd$<[^_]ÍEE}ԋU D$D $!9v9uɉ}ԋ}Eԉ$`Et<$qEt_}1} U؉D v9uD $Iu݋$$U؋[UEt&v9uDt&}E 6}E}E$tE}1}t&U܉D v9uD $蹩u݋}MU1EU؋EԋUЉD$ED$ T$$讱׋E9E}6UB UЉ1yƍUd$]uWo u,tRU D$T$$S]u]ÐԺD$0D$$趺y1ˍt$Jt⍃~4$D$Ҿ҉t o1낋F4$P㍶US7n d$܍ED$D$E $虨1t E=wED$E$d$$[]fD$$1fUWVSõm d$ E$>Ǎ $.ƍED$D$E D$ D$$!D$4$<$踙t(4$謙t<$蠙$X$uLEu<$D$%d$L[^_]Ít&D$t$$t1d$L[^_]Ðt&4$8$$訬tE4$Ɖ<$$ۤt$T$ƅ0>4$薰@4$D$?Eԉ4$$E^t&bmt$$9$($E=4$EZƉ<$PMЉt$L$$ UԉƋ:B$P,v϶D$$>1$'1!D$$1ҦZp$ڽ1Et&'UV1S-j d$ЍED$ED$D$E ED$ D$$8tUBxTyHHptA$хtd$0[^]Ít&Etdu@Eud$0[^]Ðt&@ 1D$ D$$$譣륍v$訥to륐t&賥u$軼`&'USi d$̍ED$ED$D$E D$ D$$"u1d$4[]Ðt&ED$ED$E$GxՋE$ʍ&'Ud$ȉT$$]up'i }ƉU1誾x]u}]Í&$EUt$$mE4$D$EDUE$D$褧E$U܉D$(U$E蒠U܋Mtzt_UtAt&UB$PF4$Pϐt&B$P봐t&B$P떐t&AU܉ $PUrt&M؋UuAU܉ $PU܋u B$PMtUt t tUu A D$֋ED$D$Ẻ$Eԃ$wLtǃ҉tVǃǃP$RP$RP$R럍USP\ d$̋ EED$ED$ED$D$E D$ D$$R1tED$ED$E$qd$4[]fUWVSÁ[ d$rPEȋEӥEEȉ4$EIut G@W /EE$E1EẺ$EЅtlMD$t$ $t=E$UĉD$|$qUt+tHMԋtW׉ux뮐tUVB$PHGUĉ<$PMԋUċuAUĉ $PUĉuԉfFUĉ4$PU뚍&u B$Pt&Yt6uԅtMԋ ŰMЅuEEԍd$\[^_]ÐMЋuދA $PEz+M̋}ЅtUЋuB$Pz&<$<$D$莬EЉ<$ӝMЅEЃt&B$PfA $PfG<$PfF4$PA $P9G<$PfUЅUЋB$PED$UȉT$$菑UȍED$ D$D$T$4$t3,D$$MȉL$$6E fUd$EUE Ud$EUE UWVS螽UW $dE eU1҉E$֯)MD$ $v襲 t9ȉu^}EpD‰$腧‹pu1yut&D@9EEU9&pD$<$蚥9EME9uEpuuU$pt$ñlj$UDpuEUlD$ upD$ED$4$$t$$褱El1U v9~1tɉuvHl$Ql9ω$vUe3E$[^_]ËUElp$ݶElp9tE{}|E{1 E}E1|&ȅtGD v9u~=Dulp$lpEuNju{u?tpD$|$$(ƋpiU9UEpt$$hNjp=E1}Up$舭NjpU|M9M}yL$EMlD$ D$ $lyK0UEpt$T$$脰pM|MEME&lp蟎lpDG<$PpF4$Pp8}ED$$$軶EMAl $PEl(EGl<$PlTD$$$踭EfGEUGl<$PlxD$0D$p$艝EpfUd$]E 藷NQ u$x4$ר]u]Ðt&ӌ1uڐUSPQ d$싃u!E $$6d$[]Í&D$0D$$趜1yƍt&US×P d$̍ED$ED$D$E ED$ D$$x1t(UtLE$QtED$E$[d$4[]Ít&D$$$֫1fE$ŗȍt&'US O d$̍ED$ED$5D$E D$ D$$2xu1d$4[]Ðt&ED$E$x܉$~Ԑ&US蠵WO d$̍ED$ED$@D$E D$ D$$wu1d$4[]Ðt&ED$E$辟x܉$B~Ԑ&Ud$؉]uN KD$E u$t$41tE􋓜9Pu4$#E]u]ÍD$$$6]u1]fUS萴GN d$td$[]Ív'Ud$]E WN D$Eu}$3u]u}]ÍE4$D$TD$פE ut&@E t th1EЉ<$EԉD$tXUE$UPEЋỦD$ ET$|$D$$ǃ҉t6]u}]訟D$EԉD$<$st1F4$P뿍vUS L d$E $xd$[]Ít&'USçL d$E $J1t$Id$[]Ív'US谲gL d$̍ED$ED$rD$E D$ D$$ttNEPRTu}tUD$E$vE}҉t Pd$4[]Íd$41[]Í&EP$Rf8D$$$v1fD$$萌tEPRTa0$tŤ|p UVS6K d$ЍED$ED$ED$zD$E ED$ D$$st?EPRTtbD$E$3td$0[^]Ív1d$0[^]Ít&Mt܋0$tEu븐t&dD$$1$$fD$$@tEPRTTUS`J d$܍ED$ ED$D$E E$k1tED$E$d$$[]fUWVSõI d$ԋE $xtZ@@pE&x9tO<$U҅tq${҉u֋VE4$REyNjtfd$,1[^_]Ðt&tPd$,[^_]ÍvG<$Pt&t(訄u*|d$,[^_]ËG<$P1뱋G<$P͋$Jj t&벍&'UWVSήÅH d$ԋE $HtY@@pE&|7tQ<$U҅ts$z҉u؋VE4$RE}ɋtgd$,1[^_]Ít|d$,[^_]ÍvG<$Pt&t(xu*Pd$,[^_]ËG<$P1뱋G<$P͋$iݠt&벍&'UWVES蛭RG d$D$ED$D$E D$ D$$ouF@TM4$M耟p9F${Ɖd$|[^_]ÍнD$$$buG<$PU܋1d$|[^_]ÍvE4$E~ 9ỦEUU9FFd$|[^_]ÍM4$MJE 9ẺEu (9FtU$T$ۤljEEM)ȍU܉MEEEUu&D$$D$ED$$/v‹$UwUɋuuN EU9URuЋMȋUԋA@4T$ $P VM9MBWUBWWF)9MNu;u@M9M2+Mԅ'I9M}BE9E}}?MEL$UM$֑UMME܋MH G D$T$ $SG<$PM$L$zljEUE)M܉EEEUMu|$$!UD$$D$/t‹N$UuU?ɋuuNEU9U!uЋUȋMԋB@4L$$P VE9EBG@WVW);Mu;uMMM9MMщMMM;M~7}?EU9MED$E$؝UEЋM܉T$LG $D$`G<$PvFU4$PUt&BM$PMt&MЋEW΃TE1P$Rt&FU4$PU>t&BM$PMMt&E܋MЉ΃P G 5t&$EE$E|ED$$0EKEPBWt 8dỦ$t!E}ȋMĉ $kE;; Eԉp D$ED$$UԅB $r҉tTt M9M}`UȋMЋB 4EkvYF4$PKv4$`r벍WE<$RE뛍&Eȉt$$1҉tVy}ȍ&<UċMԋ%A1 $Pt&VE4$RE뙍D$$$G<$P}z`U9UUċMԋ1A $P#f$萘EuF@4P@ EEEuĉ}vD$$ED$EԉUD$$4oUNj<$p҉umEM9MUċB@4@ MЋUĉL$$Ѕ 9M2xUȋE܉t$T$$ژE{WE<$RESt&F4$PTfB$Pf1U<$1RruF4$Pt&U܋uE1P$R6&҉aOv9u}}ȃF4$P9u~ӍE܉t$$+‹B$P}G<$PD$$$0E܉t$$ї}rB$P!MD$ L$T$<$o;EEȉD$E܉$*lu҉[<$1P9GٍUWVS辡u; $d uu܋t88D$0D$$6y1$[^_]Ít&E܉D$ED$t@Pt ]u}ȉ]Ív'Ubj* EP; t3;t+;tt#;Dt;SsD]É'Ud$U]B) ҉utLBHTuN@0t_tWtMD$$Mvu!ae1t]u]ÍrE 0]u]ÐD$$$6]u1]fUS萏G) d$EP9ut&@P9t;t9;tt;t;tB d$[]Ë@@@$GP@$:PfӍ&'Ud$ȉuu ]}è( }F@WtNt G@W t^E|$t$$|҉uVE4$RE]u}]Ít&QD$$$1fLD$$$ރt1릋F4$P1$要I1|'US÷' d$E D$ED$${Xd$[]ÍUd$ȉ]u跍n' }Op8NVɋ~FtfE]u}]ÍE <}Etk<DM fuE vu@E؋E pEu؋@ ƋE8E;HUD$$'ZMUЋfM܍EL$UЉ$|1ɋUEučRt$T$D8$gdEE؉UЉD$4$]lUuHM?t&D$$|1M}M}cEE1YE~EMAIEvw}}GNMV$|$dM&EdEU҉)uu}v>NMV$|$dl뜋~v|$$d2cdE-00}MĀ9quUBJMuMeEEVvNAT!N M(REK#}I}}!(ՉEu܅ҍ PЉMEE@Eu&;ti&APp@p F3PUUR tp}U2}4p4FE܃yv AAAQ D$UUT$Q$UhdrBENBu9uFE܋F҉uP$RՋ| Mvu},6l,*D$$SjEE $lEv?1cU| NMV$d|$IdEB$Pv>FEVUG;lE0A#EL$|$$TEU00MEUNMV$|$d:Ov>NMV$|$du9v>NMV$|$d9[v;U1B@V"Bj, a,NVU׉UET$ $dhD$|$ D$B=hEd +}*;UEtMd $]=EdEAM(}t<9A1Et$|$$[MEMU1UR1tv>1ɀtvFvEUT$ʉh<$UEh(U(tz~FEVT$|$Fd$idEV(G<$PvN>MNA;l\/;)/ $h|$@EhZ=ME`1UR1tv>EtvMFEVUB@4&x&}t5MAPTu$@0&&&t2GPTu$@0~&r&e&ED$EEE$0x7EUL"}tMh&t/"EU҉"1FE| |$F$?E/UvuU| 9G!U|$B$IE>Evu $uGE }E }eUU+B UT$D$ E+EL$M $7uJ͍}UEpUHtUЍEM9A,E}uEtFE܋vuF@W 0pE1tUE܉T$$tEEE}tU}tMu A $PuU܋/9U։UM&9v>uGh<$PhыE@E@EE@EE 6FVVFuFV~}V~FuVUVFNFVMNVN}~FuFEV$dH7?P8&v>NMV$d|$?Edv>NMV$|$df,vN>MNA;l+;l+ $h|$FKEhvlV>UV9B' $d|$PEdxEU҉1=v>NMV9B$d|$\6Ed $huYEhȃUv>| @uku $hu/aEhʃx#MA v>FEV$dL$|$8Edv>NMV$d|$3?Ed~FEV$d~bEU| B7<9P)|$$4E15EvuHEvU҉EU9UtD$<$LE t?UMMA $P1ҍ d$H$Njd19Qd|$$-]EdEt xL MvuNMvuu4$h7FE:(U|$D$5MEE'Ett҉ `Eu}t$<$B}t@@Wt ~_ Et$$7Ǹt%U<9J E|$t$$B҉]Vh4$RhC~VvUMA@WU}ʋM9M#BM9MMEMEM@Tu2;Dt*9t dL$$Dd(MA@W 5Ed$/9d4EdL$h$Ndh4B;D#9'dL$$mCd'EB1@W$[yU#U[2}!}FvuG$E@="4~N }VFMyQ~~}~Ev@$dhD$3dEhV}EU}v"EvlV>UV9B$d|$4PEdv>NMV$|$df.v>NMV$|$d@<\UBJUFEvF;pu 9N;uUudh4$@Edh ɍE1put1Mt&v9}bU$l#ut}dp3dG$}L }щufv. uBh$Ph̍VUFEEVv| L$$dh|$JdEhB$PhFE~P9|9 h<$)Ehx2uE v>NMV$|$d6v>NMV$|$d0v>NMV$d|$XCEdcv>NMV$|$dzL5vM>FEV$L$|$dF v>NMV$|$d+v>NMV$|$dT>~v|$$deLdE@B$P2v>}kv҉;U EDv>NMV$|$d-!v>NMV$|$dMvM>}$}UUMx} UK}UR1tv>1ɀtvvʋhED$<$UEhB$Ph U| MIɉM|$ $JL<$18VNUM~}~B@W BUB@W9z/J WMD$ $"Du'MEpUMD$T$ L$|$4$%E}uEFUMe)}u}!>1z vFEV$L$dh|$'CdEh jG<$PP8v>NMV$|$dFF!EVv@dhD$4$+Edh }Et_RE2dht$$+EdhuF4$Phdh u2Rv>NMV$|$dv!A}}SG<$PIB$P+Nhd4$QdhSB$PJh$Qh>A $PB$PMuQ$t$D$<$EUNEEwWh<$RhR D$D$<$v}E}E(tUvM $3vxUP}ĉU8x‰E@}ĉD$ BD$xD$<$ $MEAEċA $PEUD$$EĉD$MEAPUE=1;}ڋM<$L$E|뾋U<$T$EyEEPTn8tGW@M|$ $P;nuM9A E ED$E܉$1E E}tuu F4$PUB$P|MFE~NVF~BUB$PEE.Ev:EĉT$D$ $4MUMċME܉UEQz,EH8P4MM@|MA $PA $PzE$D$ )Ej!E<$D$D$)YG<$P B$PFd4$PdF9v uI<:RuME$D$P81EG<$PJB$P,B$PfB$Pfl9G6d<$(d9JB EB$hP}h!B$PbB$P"vvvMMUɉME ;E9P D$$$8?Et҉ Et҉T E܅t҉sE}}UEE}UB@Wt4$f;~"EP U҉uыP$RƋUB; HTɉM ;t E@9 E9EAd $Pd[1p11lB$PG<$PW MAT$d|$$Pd<@EMAT$|$$P@EL<$D1A $PB$Ph}Ā?uGh<$PhBh$PhG<$PFNEVMASA $PB$PmF4$P9B$PfU܋B$PE|G<$PB$PBh$PhMA $P9GOMB)ȋJ1d$#EdA $Pd}tpEd$ d}uAd $Pd3D$d$e;dZ9GOMB)ȋJ16M1+ɐtȋU|:RuUUF4$PFNVFU׉U}= $h8‹hȉux MmM9| @uMk΋ET$d$jD$D$$ 1} ML$ D$TD$$$tD$ $u։E'D$$5EE}E}钾ED$t$$E}N~}}PB$P B$PG<$PMGUB;-E8E䋓9PU܉$T$UT$b}EhhUB,P9D $l萲1,2EE$$@(ED$ED$E܉$%uF@WDEt$D$E܉$;}}UdEE9EEd}}wBWu1@0~t FEUL$hD$$Eh 1E1BW@#E܉D$ED$E$#B$dPdEUB(x dD$$$ 3~@ D$8D$$$UL$B$$2Q AEMɉMEh$.h G9GEċUD$$ȉ蒳E9GGEAQ17h$EhdGMAT$DED$ AD$|$d$NjdLUB$P@B4DEEJ8MRE\D$Ud$m0d1頻-My $D$$ƋdtG:D$D$4$Eu F4$P}aEN$C D$p$/E}EۤEȍD$L$ ML$$1 dvU܋B$PEUD$ E܉T$hD$D$$F$‹h$ddt$g$pME $hd)dhtFEL$D$MtT$D$L$ D$$$eMET$t$D$D$L$D$ D$D$0D$$REBA $PUE)э8@(PD $L蹫1 MM6t]U$T$ u"Uu MA $Puu F4$P0$ u0Eh<$Eh~eM#MAp E$`5Md $_D$D$$dt$T$ $ Edؿ1<$)EV1ҋ0EM8t&ttuty@BW@t:v9uT B@TttD$D$UUD$T$0h$2hyYMA $P$$ eUMBP $d3Eh$dhD$T$L$ D$$ D$D$0$xΐ1;U91;U,1;U1;UM;Hu}t xC1EtD$$UҋhEA׿}tduQ t$D$I $U'B$PE酿ut$ D$|uQ t$D$I $pKtt$$U҉E@t6D$ u4$T$D$EE1E9M8IED$t$$hEA}Q D$UUT$UI $负M|A $PEn19}#UB$P1E)E<$D$qEUD$ED$$w%EWEAd $PdF4$P骽tt$$UҋhEAo}Q D$UUT$UI $藞:M!A $PED$D$4$)MEA u F4$Pun Q D$UUT$UI $ا鞼MtVEnA4u EA4EMA8tMAt&R $P$Rf;U9riE̅uԉ|$}̉t$<$#yUB u  MMA,Pquq]]Et&U܋| U+M1Q$}t&v9u D D$E$ uڋU؋8$MU܋uQ 8}EU܋G,9PoMA(xt/~-u,1u䐋}T q,}ȋv40@Q(9B܋E@ U؋B t҉5uF 4$L&QEĉ $REgt&s#E8Mu؋AQM̃RLDL҉E@EM9M+LD$$ d$\1[^_]ËE+E$Uu؋B@LTLt E9EEu@9ƉQ I1M؋A P$Rt&$}M܋uO ILTDB$PG@W<$MƋA4$D$t$ D$$$~G<$P1qP$RURUUz9}+}(9}}/uM؃8ME89v9E1)9}O9u(HM؍D>L|v9u(,uE$tڋ҉uϋP$RċUB4$uD$TD$$U UT$ $m1xBM$PMG@WJ<$UƋB4$D$t$ }uvuG}D$<$n<$D$WEۤEЃ} ۤDȃ}(uEE@t EE@4UĉM$VUċMT$Ut$L$|$T$ n<$D$vUS çd$̋ED$E D$ED$$D$ D$D$D$D$D$ $d$4[]Ðt&US 7d$ED$$d$[]ÍvUd$ȉuu]}A tFt%D$M<$EUM 4$/ ]u}]f4$몐&USÇd$싃t d$[]Ít&KD$$epd$[]Ít&'UVSo&d$D$$ D$@@@$trD$D$4$@t\҉t1td$[^]ÍF4$Pd$[^]Í&P$Ruf뻐4$t&렐UWVd$EBMuoBRtE $MMG~;1M vv9w~&G tPE$Ev9wڋMAQ <Ad$ ^_]Ud$]u@ËH0%qIp0TUT]u]fD$$]u1]fUSp'd$ v(D$T$$1d$[]Ð ᐍt&ᐸ7ِ8ѐ9ɐ@ t  u:뮍;롐C뙐K두L뉐O끐NvMf&'Ud$ȉ]u>}PU$ ƋUt"1B$r$]u}]kUVƍd$tVR(BVB(d$^]Í&UWVSõd$EЉUEaE E U܉EԉU̍EUEȉUčE̋UȉD$ T$EċUЉD$$E܋P ;EtUtEԉ$EEPD$T$$tOD$Et$$|x8tVG<$PHF4$Pؐt&tpUtWu3EEd$L[^_]ËUuߋB$PEԋu‹G<$PE뷍vB$P랋F4$Pt&끍&'UWVSNd$ԉEp$t0&ufV t$I >4$? uUt҉SUBtB҉#UBtB҉UB tB ҉UBtB҉UBtB҉tgUBtB҉t;UBtB҉u P$RE$3 d$,[^_]fP$R뺐t&P$R뎐t&P$R_fP$R/fP$RfP$RfP$RfUWVS|3d$ĉE$Eg1}8UЋED$B$M!EpU@EEM؉ $EE%EM9ME$6,M؋UA PD$T$$M܉t$D$ $uG<$PlF4$PEM9Mct&EU܉PM@ D$$UBR$M‹@ T$$UBMA$A,A0E ǁǁUB@MA EE@UЋBtYD$$MЉD$A$-UЋMB@AtEЋUP@E31tMЋAP(d$<[^_]Ít&u G<$Pu F4$PU܋EBfu F4$Pt&Ed$<1[^_]ËF4$P1&d$<1[^_]Íd$<1[^_]Íd$<1[^_]ËB$PEvUWVSsd$ĉU@D$$W |$D$ FD$D$$1t7Et$D$$tD$E$E҉t4t ҉t=t҉u P$Rd$<1[^_]fWE<$RE뻍&VE4$RE벍& ǃ&Ud$ȉ]u>}ƋBT$D$$u]u}]Ít&D$4$҉t tϋ@ϋWE<$RE UWVSõd$uUԋF9ȉL$$Fp9tT$$E؉t$$VEE1u)z+t1&f:8t D$D$D$ FD$t$$LVVFu(z*tvft$T$$ƅtNEԉt$$_$Njt e[^_]ËF4$Pe[^_]Ðt&e[^_]Ð t$D$ T$$ryvft, D$ FD$t$$;Bt&Ft$D$$ fEԉ$Ulj$t:D$EԉUЉt$$ Ux@B$P F4$Pvt B$PFUЉ4$PUϋ D$D$ Ft$D$$7>&Ud$ȉ]u}J hɉtlB;BtPV]u}]ÐxytrT$FF U$UtT)F <8T$D$<$F럍v$‰F t1@FFm3cUWVƋ@P(1xSF@(P  BEB Vu"ǂFP(R D ^_]Ít&'Ud$uƋE }$׉UOxE}u]Fu}1]Ít&UWVƍd$@P(F1xkF@(P  BEBEE uHEVu"ǂFP(R D d$^_]ÍvE붍'UWVƍd$@P(1xVF@(MP  "SJt?Vu%ǂFMP(R D d$^_]ÀH뻍v'U卤$(T$ueE1]} wFd$F@ $ hF@$ lF@ $ ptF@$ hD$L$$ldL$ pL$tL$F@T$ D$^4$@D$$D$4$Ue3u ]u}]t&UWVS Sd$U܋B(PUAxUȉMCt&FU@ƒtV$<9}U܋B(D E‰"EuFU@\ƒuM܋A(U$lM܉E̋A4EЋF@EԋE$FM̃D$L$MЉL$ML$EȋMD$L$ D$$Mĉ $ZUfFM܉L$d@$upd$\1[^_]Ðt&Mغf $&tڋEܺdD$F@$tU$d$\[^_]Í&E$ԍt&'Ud$؉]u} Ytt1 t]u}]f@$]u}]Ëp ]u}]0u]ÍUWVS բd$ĉUȉEE$$vtXEủEЍ}E܉$t&UER @U+EȋM̋UT EЋMԉD$ |$t$ $uËu̍d$<[^_]Ðt&UVS6$eU1ҋPB,B,D$ D$ 4$D$4$Ue3u $ [^]y'UWVSõd$ĉE؉U}BM 9zzBBEEԉUАt&Eup VFUXD$E܉D$ EԉD$Mȉ$EЉ$<1Mȍ&<9LucUEE9BEPtE؉L$<$Ubd$<[^_]Í&ҋTf9LtfVE؉L$<$F`@‹MA@$U@EUUBtEMD$$ MUĉD$T$4UT$0UT$,UT$$UT$ UT$UT$UT$ UEL$|$(t$D$B@ M$EċMx փx$@(E E;@(10t&Ud$؉]uWƉ}h@FxxL@ $FF|$$x@F@$t u]u}]Ðt&F]u}]Ít&5$밐&Ud$ȉ]U^}} uU܉<$謺U܉ƅttB@Wt>_t]u}]Í&~_u$j4$EOE|_UD$.4$UUufR<_tt1ы}U܉M$AE|8|$NjU܋MV@_ED$M؍GT$$7M؉t$D$!&|_Ot&t&'UWVS^d$ĉEUUEEԃ}BH Mt}uu ]&UT$@$tnMD$A$vE}cHD$$Qd$<1[^_]Í}uvt&t&1d$<[^_]Ðt&MAxuH u}$냋M}A@Ev fvU}B@EwUԋUBQ }E䍓Kd$<[^_]f1U܋E4$҉t%EEd$<[^_]VE؉4$REҍ&UԋfMԋfMԋfxED$D$$dF4$P1wt& at1҉t$@$ED$҉F4$Pt&~볐}뫐|룐[Zepb`&'Ud$ȉ]}ΎNjE D$uUUG@U$ƋUt4$҉t/xEU]u}]f]u}1]ÐVE4$RE&UWVSz1d$ċ@R;~Fǀ?vt&d$<[^_]Í&vGdD$F@$d$<[^_]Ív 6 WTt(  D$$Dt&1d$<[^_]Ðt& ƍGW$3vGEtU? 1ɉu}܉Ήt&TEtv1t9|}܋uEg$t&1oEJE'E}Z EJ 1FE܋U$D$h9} MTu1&WW tG j D$OMUB 1ɉu}܉Ήv;7TE)u1WG G D$hD$$1n&E~ElWZEo$D$8d$WBU$nD$FM@(HFH( W FU@(PFP( t&W1EtfUN‰$h_E1u;vGTEa16E\v9uwGTE)u1OM g$M{Mʉ$1ҋMc ҉QEЉ $REfW~NGE FE#G P>M}܉UԉM 9}U܋B  wMԋ$jIEغo$D$gXDM9IU܋B TMMM*1vW.GEtU1ɉu}Ήt&TEv1t9|݋}uO ɉMtrdE}܋EU|dD$F@$dWRUEM; |}܋G  E؋W1ɅtKWtM-MMغ $\t&W t&GEtU1ɉu}܉Ήt&TEdv1t9|݋}܋uEf$Gҋ@@EkG<$D$-GWD$$ -lj$qUD$&!t&FJW^.VZt&G Xf,G_D$F@ $X3vd$zF t cYOE; T$@$d1;EMEG TM2MGT  w$j}.$nD$FMغ@(HFH(hTF@(xFx(vG<$P}GʉD$E$D$<$MwEغ$|Mغ $lU؉$\t&UщWVSl#d$ĉE܋҉U+1Ufv9u|?uE؉t$$MEt:‹E$MtVUt"E܉MMMud$<1[^_]ÍvBMԉ$PM͍&d$<[^_]ËUuB$P1܍&UWVSn%~d$UME@QUBǀ9vd$\[^_]ÍvEPJ0~!z41u t4 @9|퍓MAt yMQ vE.P 1d$\[^_]ËMQJ0AItB s,D$D$qE0vL4u捓`[MEQeEP EoGMQ EQ)Ut&EHMAEtE܋E܉$EUB uMQ t @%$Eԋuԅ M1~#u؋}vWT T @;EuMQMA;B q-A  UԋM؋u A $PdEd$\[^_]MAq҉UdEM܋U|B t @ $ƅMt$dA@$# U䋃 D$Bd@$EXMD$kA@ $2GED$.$wop f`wD$.4$M3)4$D$EEUD$Bi@ $EuF4$P눋UEd$\[^_]UBEtE܋MQEtEf>EU܅G 1}dt&MAMʉIv;u UBLE؅uʉGu1Urg  D$D$$/1U1Bt8MEQDG}؉E1}t&v9uc;u}EGTEu1E1x v1t9 TEu1UBJMMQ EwOS%UEd$\[^_]BEP1tSE>MQt4EEP tE$Es*UEd$\[^_] UEd$\[^_]PUEd$\[^_]UEd$\[^_] ErƋEhE܋E]EԋERU܉E؅4,$}ԅU܋E$yD$~MA@(pAp(ȉ4$蕾E1xvTEv1t9|ݺWEUBnh0MԋED$ $[UBEtE̋MU܋A@(PAP(M̃EMċuM9M UM܋B|Y FǀFWEtwWj$ @UЉ$oD$fRv>W L$HO }M1ɉEȋT!vM1tUȋ9|ՉMغn}D$ $5FUЋ@(PFP(tE[zEP:ubBt[8~UUD$D$BD$ D$,D$$赙MQEE$pED$.EU䋃D$Bt@ $EfMQ$EpH$E,UB@(pBp(MEIM؋xyo1vv;7]TEu1Mظ*t&4$XvU؋E$EM9MUB{vF4$Pf?D$.w4$裡tg)4$D$表Ɖ‹E$V҉uVE4$REvc&$t&E$UEԉD$Bd@$EMԋ|UE؉D$Bd@$E[M؋GUMBkD$A@ $U܅^1fcx*QMD$lA@ $`F‹ED$9}UBtt띺PoVE$bMEQ tLEPEn‹Ed,VE$Zt&UB$D$FD$FD$ D$FD$F$‹EMEQ EPEη‹EF EMA$D$FD$FD$ D$FD$F$>,‹EBEP E,MQSMy uغJHU؋B$P1$跱E&U؋J t71~1}1&v;7}TEmu1D}܋MAQD$E $GUB @81 UBPE $xdU؋EEU؋H1҅tQ MA 9U}ԉfv9uG TEuE1 T$@$dE1PU䋃 D$Bd@$E[#EF1 A $Pv}ԺE ƋEM1ҋA t$EtN1$t&E$Dv1t9|ՋEPE$F4$P맋B$P EP]F1+P:8~Z A $PD$D8$w#$%j1JTE9 kXEvUM1B@(HBH(Ex 1t9}@TEq9v$L1UM؋B@(HBH(b&'Ud$ȉ]uw.j}ɉƉ讳E܉褳Et@E܅t9EOtEtD$F$$CWqu1]u}]Í\tۋiD$F@ $9t)tiD$F@ $t$ojWU$FEz$D$$FU܋@(PFP($tDU$qU$XW&O u1fTE1t9|݋uWiFdh0 D$F@$;FU@(PFP($'QXoFh0$j_&$B)0q&'UWVSLgd$ԅ҉EttR:tD19d$,[^_]fv97~TEud$,1[^_]ÍR:u9EEtЋE$LtzUWVSEfd$ԉEUzt67~01 t&v;7}!TEu1d$,[^_]ÍUMBdD$A@$覽tɋEHEt+҉U~"}1ϐTEdtv;7|}؋MܺfE $ӼrEP@D$E $!PUBPtMAMQPUB@ $ ~‹E$Q|k$̋>‹E$JMEQ REOSE:EƋE+:E$ҾE$_YEʼ1u$E$+v1t9|ՋEPE$fu F4$PEd1vUB@P$R)F4$PvF4$PF4$Pt&'UWVƍd$ЉUͬEìE蹬t)Ut"EtxD$<$u 1d$0^_]ËE1҉$!tEPptҺDpt‹FU@(PFP(F]ǀE$D$胺tEPpU1ɋB }uljTEBv1t9|݋Eu$q}D$  FU@(PFP(W藺F1Ƀh0UB}uljt&TEdv1t9|݋u}F@(xFx(&'UWV֍d$ЉEBʽuL~ t57~/1 vv97~!TEu1d$0^_]Í&d$0^_]ÍvE萪EE腪EERMtUtEF tENEtEx$ED$蜸kUBU@(PUBUP($E1謨;F1ɉ}u܉ljfTE v1t9|݋UE$q}uD$UBh0Mt-~ 1vTE|v1t9|݋UBU@(PUBUP(iEEOUBǀVE,Eo$ED$: EշUBU@(PUBUP(E蠷WE苷&'UWV֍d$E=EtVE.tHFuL~ lb1vv97PTE u名t&d$ 1^_]ÍVEtغoED$<$tE诶tF1ɉ}uljfTEtv1t9|En$E}uD$訵PUB@(xBx(E1)~ t]?~X1v97~LTEut&~1vTEv1t9|݋UBU@(PUBUP(d$ ^_]Í'Ud$ȉ]uî\}ƉUKljBEu1]u}]Ít&t$zD$}t΋F@(xFx(<$蛤tE1HuTEt1t9|uWʴgFdh0 D$F@$蜳9FU@(PFP($E1Hut&TEL1t9|݋uX&Fh0'UWVƍd$UͤEälj躤E谤t Etu1d$@^_]Ðt&UtUE DEPMt̺DMtFU@(PFP(]D$ $M蜲t聤zEMcUBR҉U|1҉}؉MԉVvEo$D$.軲9}~UBTu}؋MԋUE E;U$MsUA=MsF@(xFx(}1M4fuFU@(PFP(';}}gn$KuE+EUD$ET$$UMMUE;YMEq$MD$觰MF@(HFH(}qU$-SUWVƍd$UݡEӡljʡEE趡tHEtAUt:Et3t/UEDxED$ $Mut&1d$@^_]ÍU$1MtڋUEPM7tD7MtFU@(PFP(E$]D$MQq2bEMKUB{҉U1҉}ԉM؉Wt&Eo$D$ޮ迠k9}~KUBT:uF|@ M$蠭MM؋}ԋUEE;/U MYVծEM.F@(xFx(}~f1M4fuFU@(PFP(v;}}(n$ӬuE4MEq$MD$nMFU@(PFP(WMM_Fh0F@(HFH(AE UD$$UMMEU; Ud$؉]u}׋RݺÔTtjEW+toW ttX$茫]u}]Í& dD$F@$ѫut&]u}1]Ð dD$F@$虫Z UWVSáSd$ԋw2AD$D$$1d$,[^_]Ãt3u̓}TRȉM_M1f}&B҉U1}ϋTvD$$蔮d$,1[^_]ÐR }uȉM܉4$MR}vr1}}|#d$,[^_]f}tJdD$A@M܉$Muuf<vȺM衪Mj1^&D$D$ T$$d$,1[^_]Í&=dD$G@$v9u~IUBT4E$_uR볍t&ufȉM܉4$!MHvȺcM$Mq6W1Et'}tȉM2MAEWtmE}vuKȺMM(Ut&EȉMM}u+tzt<ȺM蘨M렃}e}v,ȺcM$զMTU82LȺcM$蜦MuȉMMzߍv'UWVSNOd$u E E1}$tE؋EEEut$$EMM EĉMȉD$EEt$$耮EEMED$ $UMEQE誮ƋEXo$t1d$\[^_]Í&$t‰Bf1Et$oEąt$U؋uE؋P$Rd$\[^_]ÍvtCD$D$1$蚆늍UEUkMEQ誾1҅E1趸K胈; t&D$1$zt&EE1x&TEDtv1t9|et&Ud$ȉ]u臲>L}} w1tIEt$ |$D$$貊1tt$ D$|$$‚E4$跃E]u}]ÐUd$؉$]uëK}WT$th 4$D$ӛNjtVtE<$ZƋtet,FD$ D$$$踄t]u}]ËF4$P럐t&F4$P]u}]fG<$Pu뼐Ud$]uJ}u4$D$vt"E4$D$蓙t']u}1]É1]u}]fE4$D$YpuƉ4$蝆Et@ EԋEUԋMԍU419r+R @9swzRCމT$$ RE}ԋU F <9 u@Uxx xx xx@ ׃IP8Uuԍ<9s_@x\Ev/u xx @x@suĉT$;t$$膘҉uVẺ4$RE̋}Ћ҉WẺ<$RE&'US蠮WHd$E $*d$[]Ít&'Ud$]ugH}u4$D$Ƙt"E4$D$t']u}1]É1]u}]fE4$D$muƉ4$Et@ E̋EŰM̍U419r?I@9s/ vcwIwIہ'FIʉL$$GE}M̋EEЋEċx E9UU1U&G#MЍW wTz&E1v0gfffUԍF)ʅ;EM̃E9Us@냃cf v=fdv='ffv=wjff'qD$EĉD$;$ Mċ҉tlMȋ҉CQE $RE/w*Iy=@B=@BɁ`D@B?By I FCQE $RE냋UȋB$P1t&USwEd$E $xd$[]Ít&'UVS菫FEd$Ћu4$D$uq,4$D$Օ4$D$蹕u&1d$0[^]Ít&E4$D$!d$01[^]Í&E4$D$虓u܍E4$D$juɋE+ED$$茣tH UE9}?REI9D$t&EED$4$肑aED$D$ ED$@$֓E4$D$!~ E+ED$$P ME9}@MR9L$;t$$c҉VE4$RE&US蠩WCd$E $ d$[]Ít&'Ud$ȉ]ugC}u4$D$Ɠ,4$D$誓uv4$D$蒓tF}4$|$|ucE|$D$ D$@$j]u}]Ðt&]u}1]f}4$|$豏tt&1]u}]Ð}4$|$)hv1אt&US`Bd$E $d$[]Ít&'US0Ad$EP;tGBW@tD$$d$1[]Ít&@D$$$nd$1[]Ðt&P뺍vUSwAd$E $jd$[]Ít&'Ud$؉]}臧>A@u} pFtQ<$0t$E|$D$F $g]u}]ÐFD$$$讜¸t뿍'Ud$]uÞ@@}pFt1]u}]Ít&$ F$FF t}@dEE1U܉u؋UD$D$D$iUt$$螑҉Euu؋~NV t{_D$D$ D$D$$Mqtq҉P$R1fVEԉ4$REԅjE܉$vZ$brt&E܉$M p$zƒrV1f&Ud$ȉ]u>@}uPJtXDt$B $>t]u}]ÍD$$t$$wˉU1Ut븐t&Ud$ȉ]uw.>Ɖ}U$ؗNjUt҉p t$݀tG]u}]Í&t1ۋG<$1P΍UWVSå=d$u@@E̋@4$ǁEE$D$it}ԅtD1ɉEvBz <EF׈TI9Mv u݋EȺ-TI9MwEȉEE$nM̋ED$A$Utd$L[^_]ÍvEP$Rd$L[^_]Í&D$$N1ҍd$L[^_]Ðv1ҍd$L[^_]$EtUԋEB M̋A$5EEGŰEЉD$B$GeMD$L$$l; ‹@@WtTzuNM9MM̋ET$D$AUĉ$MԋUA $PU D$$Uĉ$UċtYUԋ`UԋB$P1O ҉t.EU9U:蘅1B$P뜋QEĉ $RED$$${lJD$$t$$tIt&'Ud$ȉ$]u褠[:}U}/i1Ut?E D tAT$|$ i$T$o҉uVE4$RE]u}]ÉT$$T$2&Ud$MEU ME @Ud$MEU ME  Ud$ȉ$]uğ{9}Shu1]u}]ÍE4$D$虉‹tDt˅tTE$U|$D$kU ɉ uJE$QE둍t&FU4$PU뫍&$UD$U賟8Uld$EUU '胟8Ud$EUU 'Ud$؉$]u蔞K8}#g1t| ҉t]u}]Ít&P$Rߐt&Ud$E뎍&'UWVS7d$ԋE $蘅UEkeD$D$4$uhtiPBWt@xu:P ɉɉɉt{d$,[^_]Í8T$$E$E҉uWE<$RE҉t҉1ҍd$,[^_]Í&H$UQUd$,[^_]ÍOEU<$QUEɉ6NEU4$QEUɉ떍VE4$REUP$R11/t&U1҉d$E&'UWVSN6d$ԋE $HUED$D$4$ft}PBWt@xu:P ɉɉɉtkd$,[^_]ÍhT$$E$+E҉u P$Ru G<$P1ҍd$,[^_]ÍvH$UQUd$,[^_]ÍOEU<$QUEɉFNEU4$QEUɉ-떍qF4$P1Ud$؉]u跚n4@}uxWt]tM4$\t t$G$虆]u}]Ít&D$$$ޏ~>¸t밐UWVS3d$ċ@E2t9Pt ҉tf1V,N(UԋUV(ɋU ~0V,F0t tZEԅtUԋt5tu G<$Pd$<[^_]Ít&P$R돐t&B$Pt&A $P뛐t&USP3d$UҋE ttD$D$$ yd$[]Í&'US÷2d$ED$$rd$[]Ív胙2@U]@(Ðt&US谘g2@UH( U H, UH0 @(@,@0[]É'US`2d$D$D$$)xd$[]Ív'U卤$eU1ҋE]ÿ1u}u u$1Ue3]u}]Ðt&~؀8tӍJ$T$UetDžED$ |$D$$t E< tuʃ;<$q9E &@ t t t$sqpUd$]E î0u$sƉD$E$ptu F4$P]u]Ív'US蠖W0d$썃$D$$$ d$1[]Ív'UWVES[0d$D$ED$E$ } $VEaD$$u9FF EЋ}ЅtMD$. $ePDUЉUЍk4$D$$EVEċUt 2CMЅMԋEЉỦL$$ӎŰEt=; t5MԉỦL$$詎ED$D$E$kU̅tMԍ L$$dED$D$E$jMԍL$$5Et ҉tNEt ҉t,E܅t҉u E܋P$Rd$L[^_]Ðt&EP$RfEP$RfB$P9fMԋEĉL$$融MԍDL$$艍UFEfEԉỦD$~$XU]EԉỦD$~$8U`&UWVS讓e-d$ċED$.$cu EE1҅kED$EU܉$貀1U F@Wt|EU܉D$Et$ D$D$$ɉUt{t ɉ tTt҉uWE؉<$RE؍d$<[^_]Ðt&t$U$ pƋUg1롍t&JE؉$QE뛍&NE؉4$QU܋En01ҋ0Evːt]Et&E+ED$E$bNjUvD$ED$E$RU111PD$$U1Ud$]E觑^+D$E u$~}ƉD$E$mktu F4$P]u1]ÐUSP+d$썃D$$kdd$[]ÍUS*d$E D$ ED$D$$dd$[]Í&'Ud$؉]u跐n*}} EP0tvTuut}D$t$Ý|$ $zƅtEt$$Qjt]u}1]Í&F4$P]u}1]3}uɉ4$RuD$t$$y념USç)d$ED$$od$[]ÍvUd$ȋE ]跏n)}u}tC$;lƉD$<$Mot҉uVE4$RE]u}]f<$D$o]u}]Ít&'Ud$ȋEM ]u}(81t9F;1@W@EЋG;t"@TxU:1]u}]ÐGW@tt$U܉M|$eU܋Muz; F@WyT$U܉MD$<$YU܉EMEtcuOt&9C*& F;VEU0L$MD$$wtMtE@0~ ~ Mx9NjMn EtKU?t&Mt$$]j‹MovPM$RM뢐t&FM4$PM@t&UPM$RM_&F4$MPuMB$PM-&GU܉M<$PMUEEUD$L$$Jrn [FM4$PMZt&GM<$PM3t&M$q‹Mc&0UUWVU܍ESȋ%d$čuT$D$4$EЉUԋ}qrUԋEЉT$D$4$qE $i>D$YD$E$v}^<$gD$8D$E$vE <$D$St0D${D$E$>vo jD$Et$$v9Et9EK$|$NE$|$1t%EU܉$T$UT$$jd$<[^_]ÍvEt$|$$ut,}t&빍&}^F4$Pf|yE$mYD$EUԉ|$$ uUB$Pt&|`F4$PRF4$PfS|C|X3|#|Uiv|Ud$}} ]uшÈ"t^UtWWJTuauF;@W@uA9@Tx|19}]u}]Í&1]u}]ÐE@뷉<$zE~ى1}v9u~ȋD UЉD$<$=VUt޸멍&E@W@w9tkGW@v^E܉D$ED$E$nu|$4$^t6U܉EЉT$UT$U$gE+E@E@4$b1뾍t&'US`!d$\U$T$aUd$[]fUd$]u' ,$`\ut D$$`]u1]Í$fs]u1]ÐUW1VS輆s d$ċHu $H[cmhEt$$MB$Fhtyc1u@td$<[^_]Ðt&,$0E$_tD$ D$3D$$`usd$<[^_]Í1${zvxEiD$ D$XUD$T$$6LU$_OUt 8$7O8,D$$GlD$$GXD$$~GW3sUWVS΄Åd$$gkEsE@!UvEЍd$\[^_]Ðt&B;u1ɍEEEUȉu?JM teuԅuiudJuԺ9Duԃ9DU܉U܃EM1҅t9UhuTu܅tr9ΉuL uJ;t EfE܅vJ1IUM؉ut&uЁ &R}1tM؋9M؋DU$kDEUƋ}t u}t u}tu}uuЁ@|t&8Aut&GAuu;uЁFuЁ2fUBUЉBMAVAuuЁ-A$CEЉ$utEdLdD$U$wUBD$E $=S뫋uUY4$D$U|Uu`D$$뫍pD$t$U$TUBU D$$R7UWVd$t"u't ɉ uJE$QEd$ ^_]Ðz~1ɍ&r 4I9FufUd$ȉ]u}Ƌ@öxPtYtSGtLOuEUD$4$ЃUuMT$D$4$y M]u}]ËU]u}]ÍvM]u}]ÍvUd$]u}Nj։E;UԍPMԉU(Rv]u}]Ðɋtf@v(utK)tUGƃv]tYu݉UMMMUx%>v(uuR뜍t&t R돍&EԉM$*\Mt UԋB@WtPEU; tB@ D$L$ D$UE$D$SCEd$\[^_]ËEԉM$TM9tUD$L$ 8밋UЅɋEEU1ẺUȉMv;}}dEԉ|$$Rt^EUD$T$EỦD$ T$E UD$$Up҉uVE4$RE댋EUЉ1eUB:EUD$$D$ D$$cEUD$$X;vP8F@Wt4$>@ M}򍃂L$<$PE4$MBC5UMT$ $P8F@T E}$|$iLt&PE 4$UMuBUMT$ $ G<*@<#f9 P8F@TF$Jlj4$>9M}kL$<$zfP84$S]A EUD$$*U8P G'PEFPPBt *Bt * BBUMD$4$ЃUMeE}$|$B%t&G<*<#; PF@TF# $Flj4$:9M}L$<$t&EEfu>PU 8UPHE;  F@T MD$4$BMPu* @t&ED$$M]M}L$<$u~<4`D$$\t&M}򍃶L$<$nQUM4$-NjUMMD$T$$UEM} }G@W҉u<$PEUD$$v2E}$|$M}L$<$qE}$|$nQE}$|$N1E}$|$.E}$|$P0EUD$${vUMT$ $>!D$4$>=@AUMD$4$>UM@vUMT$ $PU 8UGPHEF@T/F}$MFUt&E$ SM}EL$<$* E$MMxˋUUEMD$D$4$RMz*uU#r1P1ҋHPP8@E|$F$DyUG }$|$W:FgE}$|$-U UP8EƒEe]Mu A $PE}$򍃷|$PP8@E4$ׅE}$򍃰|$z]G<$PMFP@1ɉEP@1ɉEEUD$$a~& 4$ABW/R6@Mf94$[MM}E$ KEɉpU$Uu B$PM}YL$<$jMEUD$$K.F48E}$>|$UD$T$4$ЅU$E"MD$C $?E}$򍃑|$M;‹MOUUUU9U7}u G<$PEUD$$1F }F PE1ME1U@EEЉEԉGE؉GE܉G E4$J$}M|$D$4$R M"EUD$$^AM}`L$<$?"4$#1UUu B$PM}L$<$EUD$$MXD$D$D$ D$D$<$+EUD$$>tWF}FNr1fEUD$$,E 61; 34$ /OM}L$<$M}>L$<$D$ t$EuD$D$D$4$*EFurMM}E$FEɉ)pU$xMUut$T$$8}t>EuF4$PP8UM }uMUML$|$$z8뉋E`MM&UWVS>[$u4D$:E4$80eU1҉DDž$} @@Dž @1t vu41ɋ@<8t8$=9<91ҍD$΍Dž эT(D<|<;KC<:; 9<9 oU$$0]|I;kD;tt:t |h0Dž,4@<0,|$ 48D$T$<$R*PBW$Nj@~'1<<$D$Stv;@|܍LD$$|$$+1 b&Eۤ D׃@;D$@D$;t9pߍt&UWVS~H5d$ԋut1@ƅuu 1d$,[^_]Ë1 1҃9t<u@E=EDE $U܉D$Uta9Et $M؍<D$|$$M؋U܋Et$D$$$10&Ud$]ugGҋMt!$ tC]u]Í&9UJDʉ$L$uϋ$zB뽍D$$~<롍t&Ud$؉$]uFË}@@W$@@W <$\"$Dž8tq9hT$ $j@@TtDž~D9EnFD$$"$9;t64$‹; SDžD$$s!0T$D$$u@%=@"x11FJt&v tLT$$ h:~|$ $0"F8UDD$<$ tt҉f|D$p1$3Me3 $![^_]Í čA $PfS|$D$p$1뜋uA1 $P{&PQPA $P7vD$ D$FD$F $`t&$Ƌ $D;E<$D$$$f. $|$7.D$D$<$="n|$$t=D$1$1&t&|//IG<$P $P xT$D$D$ D$PD$4$01D$t$$!cB1$P&fPW<$RvT$ $t$D$ ED$dD$ƋttQ; tN1PM,|$$hhB$Pf뢋F4$P $;@@T:Ǎ@/‰׀ ?$1t ftL$t$$1:>򮋃у8DЍDft$L$$tU(G1<$PL$tt"\`f@ G\<$P5Ud$4$|$U uEM}UU}uU M4$|$] US7×d$̍ED$D$ED$ ED$jD$E E$ t>U1uD$ED$E$&d$4[]Í$Eu΍vd$41[]Í&US@7d$܍ED$}D$E $Y 1u d$$[]fE1҅tP$d$$[]U1S6Õd$샻$d$[]fUS6gd$܍ED$D$E $ 1tE!$d$$[]fUd$ȉ]uW6ƋE}U$NjUD$T$4$t҉uWE<$RE]u}]Ðt&Ud$ȉ]u5Þ}$_o@D$D$D$ D$$%'3$!$$$$$$sx$[xg$CxO$+x7$ xD$<$D$(]u}]ÍvUd$؉]E74D$D$E u$T1u ]u]fut*PtK@$1)ȉD$3]u]Ðt$D$p$1뚍t$֍US37d$܍ED$$D$E $1t E$d$$[]Í&UWVS.3d$$w.E|x8tn1U v tWWT$ WD$ET$$ZtDD$E$xYuF 4$Put&Ed$,[^_]Ít&UtPEEd$,[^_]Í&Utu͋F4$PE띋B$P؋B$PE뀐&US2÷d$eE1D$ˆEUUEE$Ue3ud$$[] &UWVS1?$ e M19ƅDžD$DD$$1t$L$ `1 L$ JL$t$$k.NjtlBD$BD$D$ t$5|$$E҉uW<$RUe3u($L[^_]Ðt&딋$ 1 t&USP0d$܍ED$ ED$=D$E E$[1t UEpd$$[]É'Ud$]u/Þ@pFt]u]Ít&$%F]u]Í'Ud$ȉ]u/>}}$E|$$t0@9tT$$t]u}]Ít&<$t߉D$E|$$uuF4$P벋t1룋F4$1P떐US.Çd$ @@t$*d$[] UWVS.Ed$#EE$$x ljt$$uE$ t~t$D$<$tmE |$|$$ ҉tgED$E$%d$,[^_]Ðt& vE p0lfF4$P눐t& vkvP$R뎐t&D$t$<$!ƋED$4$u1jE4$D$y捃T1$"BfED$$D$p$v'UWVS,s$DhEeU1҉t$D$|$T$4$q Ǎ@=DžpD$D$tDžD$D$D$ D$t$$$v|$ D$t$$^l<$PlOhtlpl$t$lp`綉$m p|$D$$![$T$d;dD$D$${dD$T$$]dlD$D$<$d$?tod$p$ |$D$ t$p$8Ƅ=o=JD$pl$$;<$9lVhttpt$D$u$X p\<$\uk1Ue3$[^_]Ðt&hu<$&pMT$$ <$vA0\$$t$#\"tϋp5ht$|$$҉/W\<$R\<$1hpD$a$ vht$D$$ s&pD$$ tvD$t$$ 1bvtlpT$$b l&ht$\T$$. \pvd$!dD$$D$`d$D$D$d$fd$XtpT$$ 4$CƋ\0y0$ȉ\\t.F\4$P\tG<$P\vUd$]E&οD$D$ED$ ED$D$E u}E$u1]u}]Ðt&U܉$E,tЉ$UEU܉Džu4$뱐t&Ud$ȉ]}g%NjEu$~;t.D$pt$$h1]u}]ÐE$=U1tՋhu7T$Ut$<$U ɉ uJE$QE뗐t&Ut$|$$oUfUd$]E$>D$D$ED$ ED$D$E u}E$u1]u}]Ðt&JU܉$EtЉ$UENjE܅u4$o뱐t&UWVS#Õd$ċu1҅PxىMԉE}ԉM䋋h |$$iD9G1Utc4$8$jE4$D$CD$EU$U ɉ L|$D$4$҉tvɉtFd$<[^_]ÍvM䍓ۤɍ$Et$EщT$-$[EPP$Rd$<[^_]Í&WE<$REɉw뻍vD$$t$$ZtWd$<[^_]Í&JE$QEt&D$pt$$G<$P'US!Gd$܍ED$UD$E $u 1d$$[]Ít&E$=|u ؍vE$tƃUS!Ǻd$E D$ED$$d$[]ÍUd$ȉ]} ~ u} u1]u}]Í&|$$ t֋EU$tĉ$UtT$$WuhtE|$D$${Ud$؉]} ι uҋ}$|$K t@9t@T$$ u0 D$|$1$]u}]Ð4$u1]u}]Ív$t‰D$E D$ $uF4$P듍v )1뗉'Ud$؉D$$]}÷ut]u}]Ð0u @vt7D$<$uFtGh u$tXf]u}1]Ðc|$$6FōTD$p|$$S|$<$ :뒍t&'Ud$ȉ}} uƋE]EMGêwO v:|$ t$D$p$1ҋ]u}Љ]Í&0t&}RED$fD$Et$ $‹]u}Љ]Ðt9E4$%1҃t$t$s K]}u]#vT$4$L$h ‹]u}Љ]Í&U]}u]0U]}u]|D$|$$1vI't&,t$ D‰D$gxD$p$1\,t$ DD$D$pU$Ut&'UWVSs$DžeE1$h<$4$D$|$t3t$D$$tg1(1u F4$PUe3U$L[^_]Ít&t$D$$|<&CD$L$$$oD$ T$ $ƅD$D$itvD$@D$$Njt$^A $Pv1p$ USp'd$܍ED$ ED$D$E $1t UEgd$$[]UVSֲd$ED$ED$ED$ED$ED$ ED$D$E $uukU1; t6B9tL$$uUE4$ tpUD$T$U$‹EId$@[^]Ð낐D$pL$$^\1$e IL$|$$ $D$.&)ȉ $D$NjFD$$‹Sg$CD$NjVD$D$ D$ȉƅD$<$‹tD$BD$$ȉƋt ҉t;t$F B$P먋G<$P0G<$PsUD$T$D$ ȉƅD$$‹T$L$$Y҉P$RGD$D$p$G<$P'US0d$E $Zd$[]Ít&'U卤$]uë}ueE1kljt$$t)‰ЋUe3 ]u}]Ðt& 9DžDž2C $D$bD$D$ D$ $ƅD$7‹01D$BD$$‹tɉt$ 9҉vA9t L$${$9t*$L$L$1)t1B$P1vA $PA $PD$L$$Xt&D$T$D$ ƅD$$)t$<$8d  p$ ʃt&UWVSn%d$ċuEU܋>D$.<$?P)EMUu 2;u t.vU+M [EU؉MԉD$|$4$jUUMԉ M E $; E9E E܉4$xt?; tfE  $L$M L$UtjEEd$<[^_]ËEEd$<[^_]Åt; UEd$<[^_]ÐB$PUfM E $U؉D$|$WM EMU맍v<$EmfD$$E>fB$PE't*SD$p|$$rEB$PˍvUWVS Ŧd$ĉE䍃CD$EU$¸)EE E܃E1|E"t&҉auE|$$<@@W~*tEt$$uWV$U^E U=wYE.E؉T$UЉ$yEUЉ$EtL҉XF4$PJD$$^uiF4$P1fd$<[^_]Í&EԉD$E$txE D$E$ED$Q‹t4d$<1[^_]Ð4$Pt&P$R%fFUЉ4$PU뻍&+vev$@t-t&D$$$NU卤$D$/ $] KE u}։DžeU1!}tB4D$p1$Ue3y]u}]Í&ZF@W ?T'ƅDžD$4$ 9HAWH8@D$D$$1wdvBD$.<$ uލv D$D$$Dt vT$D$$҉uW<$R렅։<\t&D$1$ ft1F4$1P T$D$4$ 4$D$mtы@@WrD$4$BzBD$D$$T$D$4$RK&$i$T$pD$T$1$< 9t9t$luG<$Pu F4$PD$$D$G1<$P5Y$L1ITRD$.$Sw)сwL$T$D$ $Ƅ $D$4$D$-Ƌu B$Ph $P1MC$-1*u G<$Pu F4$P D$$  $'D$D$$uƅDž t1rB$P捶'USGd$܍ED$eD$E $u 1d$$[]Ít&E8|u ۍE$tƃUWVSŜd$@@E@E`$UT$2EtTP9tL$$t7E܉$h1 $T$pT$Eԍ$ML$EP9tL$${tE܉$LNj8h UЍM̉U#ỦT$vD$<$MЋ tՉD$Eȉ$čt&UԍB$t$Et%@9ZT$$FM܍EUMЉẺUȐt&EEEUЋM̉T$ EȋUԉL$D$$x@U܃:uЋEHAWtċR;t$L$/tEP U֋}tM@:u)UB:AuB:AuB:A_&h )E܉$E D$EԉL$$EMEԉL$$EtT@9tT$$nt7h8E܉$ UMԉD$T$ $EUԉD$$AEtT@9tT$$t7h0~E܉$" MD$EԉL$$&Uԉ$MAUԋMAtA҉u P$Rd$l[^_]Ëh8E܉$Mԋ $D$t$蝿E܍UMEЉỦMUąuEMĐt&UЋM̉T$ EȋUԉL$D$$8EPBWt̋U܋R;t$D$tEP U֋}tM@:u&UB:AuB:AuB:Adt&h E܉$E D$EԉL$$9$hMЉU;t&F<$D$ D D$vD$<$+MЋtD$Ẻ$9믋EUD$$%B$P$$o$tE$E]EUĉD$$USÇd$$t V$ǃǃ(d$[]Í'US7d$Pt $u1ҍd$[]Í;u䋃((uǃ $볍v'US÷d$x d$[]Ít& D$$N1fUd$؉]u^}xtR$9titD/Nj$D$$'<$ǃ(]u}]f$D$$u렍t&(u]}]Ít&$b뤍t&'USÇd$ d$[]Ð&Ud$]uNEU D$ED$E$Eux]u]Ðt&t t D$1$‹F4$PfՍ&'UWVSõd$ċp. D$4$11tjG@W <$D$$D$ED$U䍃:D$D$t$t$ D$`Uɉtct ɉtkt ɉ uJE$QEd$<[^_]Ít&<$D$&1\ɉuNEU4$QUE놋OEU<$QUE{tU9B`D$D$ D$D$$D$ D$5$11qvJ$¸t@$誸 t(oD$)$hf1D$XU$1ULR-։Ud$؉]EWu$1t4$襸҉t ]u]ËV4$ERE]u] Ud$؉]uÞ}}u1t|$$#t]u}]Ív~t9u <$ɍ@D$p|$$멍t&'Ud$]uG t҉u P$Rxǃ $]u]UWVSåd$ԋ$e%hU2$t)D$-$V҉]EE$LU܉$wf4$D$ENjthtqE|$$5҉tzuU:aUu B$Pd$,[^_]Ð@$ t&F4$PuUt$g뜐t&WE؉<$RErt&D$$҉$EMɍ]EU䍃 T$$]UfVE؉4$RE؅Z\t&Eg$vhEf$Zt&VE؉4$RE$t&U1҉W1VSZd$ԋȋ1t@ R0u}u} 4$|$[t‹]u}Љ]ÍvD$.4$01ɅtPET$UM܉D$ |$4$E~UMt1랋EE܉UMыE܋UCuj$t$$U|$D$苷UU|$4$aUrh8t|$t$$%UXD$pT$$l1D$U$UUcUS×d$܍D$D$D$ D$$3t\D$T$$d$$[]ÍUd$؉]u}Ƌ`t-$譾Njt8$蝾 ]u}]fV;Vs:RVV;Vs]R V}u]ÍUd$؋EEE؍EEE6Ít&U‰d$ȉ]u}8GtE<$ݽE<$ҽƉ<$Ƚ<$ u赽 ]u}]ÍvH;JsA;B9BsDAqr ;rs9qyz ;zs,AIJ ]u}]É 끉 u'Ud$؋EEE؍EEEÍt&Ud$؉uu]}q(t,L$ T$D$$Nj]u}]ÍvN~)ωL$9$N|$+~]u}]ÐUWVSõ$DeE1tk$+ƋBPQ F|v(D$$P1aXt&A;As0@AfhD$$fW1t&RQ}e3=$[^_]Ë=Ƌ0DžD$ D$D$$ Qv QY= W;B+ R QWt&PQ= $3tti1 t&R 9e u  Dž1W6CD$$ؐt&P1 $P $E9}Ƅ5<$%$Q&c $- $9 Ƅ=4$赳ݝ $臸t $9 hD$$v1Q$=W&=1)‰$Itp1*u 9fDr v9̉fUcD$$賸@$:9P$R|Wa<$OhD$$W1}EƉ$z($f9<$螼Su t&uTtD$t$$uF4$PtuG<$Pf<$1f9RD$$*.uF4$P뫍vQy[$/1t&D 9 u&<$uD$4$dݝ݅uz 7$"\hD$$1Q_&DžNjƋ‹.Z)DžDžDž!D$4D$0D$,D$(D$$D$ D$ D$D$T$L$t$|$$\ntAtbtitXtGt6ttu A $Pft&D$$P1AD$$c1t&3EDž1_t&D$C5D$$1B;B0@B@B;B8@BD$4$uuzݝxL݅x$QP$R<$XqF4$PP$R<$D$t$y<$Wt$PD$G$QB$PaG<$PA $PxF4$PB$PB$PA $PG<$PG<$PDžDžDžDžDž11DžDžDžDžDž1P$RD$$$DžDžDžDžDž+D$4$赳uzݝx茲݅xݝ݅ݝ$D$D$D$ QDžDžDžDž{A;A8@AUDžDžDž8赵Ƅ=4$警݅ݝݝQUd$]uîuYut@]u]Ít&D$XD$1$T]u]uD$$$뛍t&'US`ud$ED$ ED$2D$E $21u d$T[]ÍvEEEEE$aEEEM҉uUJEĉ$QEčd$T[]USwtd$EEE EE$EEE|M҉uUJEԉ$QEԍd$D[]Ðt&USPtd$EE$EEEEE M҉uUJEԉ$QEԍd$D[]Ít&UVSÖsd$u F9tT$$tT4$E$EEEM҉uUJEԉ$QEԍd$@[^]ÍvD$$$1׍v'Ud$ȉ]u}EB rtS$9ǁ~‰T$F U$?Uu(F ƒVUT8D8F]u}]ÐFF]u}]Í'Ud$؉]u}Njn%rD$‰$>D$Ɖ$#teD$$ t#D$<$]u}]Í&F;Ftp@]F}u]ÍF;Ft`@F또F;Ft`@FcB;BtX@F+]}u](3t&Ɖ&‰&Ud$؋E U؉E؋EEEEEE]Ít&'UWVSÃpd$ԋ}t(D$ T$D$4$d$,[^_]Í&уy(獴&D$M$^Mxƍvu݋G;Gt @GMMˍ&'U卤$}eE1]uBփóo=B~+B@FEe3]u}]ÐH; d;8v;;|;PrG;l;; ;po;;( ;p;;<h9;;D<$}=GHPi D$$s<$D$D$lj4$FD$$0FFjtbD$$N"FFftbD$$SF&fD$$TFB;B N@BBvB;B S@BBK D$${yDž#D$ T$D$<$huF!t&D$$.FD$$FFZD$$iFfD$$lVOȉ1)1Ʌ<$,O4<$B t&$bWuԋF4$Pɐ*D$$<>uB;Bni@B D$$x<$-$UD$$҉ I!%tDQD+ $D$dʋ4$<$F$螟D$$B!%tDWD+\D$<$4$F nFB;Bl@BnF<$ltD$$u,OȉGʉ4$?G<$PF|$$!%tDWD+D$$f{>fʼn)lF;FSs@F|$$}$fNj D$$RrF;Fj?@FmF;Fg@FB;B(@B9F;Fs@FF;FWc@FuF;FN@FB;BP[@BB;B{@BF;FY<@FFB;BPx@BB$PNF;Fy@FPF;F@FQP$RF;F8f@FF;Fu@FAG<$PL0-FyF;F%>@FoNFMSF;.F)F;FR@F`FFTFi-l~KF$V$ D$|$F$ ɉ  D$$t43袠cH([s7g<x|sk{\?KR:f)sF;Ftut@F:J$Q>GȉyhutUSw_d$ED$ED$ ED$;D$E E$脎1EP9tL$$蜧E$虋UE1EEEEE~UEUEUEt ҉tEЅu d$T[]ËEP$Rf4EDЋT$$21뿍D$$$1fUVSo&^d$ЋE uE1EE~EU؋Eu Et҉u EP$Rd$0[^]ÍvUWVSõ]d$E} D$2$襔1t|FuԉE؉4$DE1EE}~EUȋEcEt ҉t1EԅtU؍@)EԉT$$軸EԋU̅ud$<[^_]ËEP$Rft҉t1Ũ4ED‰D$$萸1뫍t&EԋP$RfUS×\d$܍ED$ ED$[D$E E$請1tED$E$ad$$[]fU卤$XeE1]ui \u}4$dD$$T$誵t&4$讋Ue3]u}]Ð|||@vrxw$t@NjttT$t$ D$$\D$<$9dt<$DtKt$ T$D$4$ D$4$讏 &:薚U1ɉWV1SZd$ԅɉU~}v(ɍ@;}ud$,[^_]Ðt&ҋfIɍvI뻐t&LD$$!d$,[^_]Í&'Ud$؉]}gZ}uuG9tT$$~<$FtbU t$T$$诀u҉t(]u}]Ív]u}]ÍF4$P]u}1]É<$訦D$fD$$ڒ]u}]Í`D$$$dϔg͍&Ud$]E7Xu$śt/D$E D$E$~1u!]u]Í&]u]ÐuF4$P Ud$]E觾^Xu$t/D$E D$E$I~1u!]u]Í&]u]ÐuF4$P UWVSW$EUEu eU1ҋ}n|$D$D$ D$D$D$<$pD$|$$4t0DžUe3J$\[^_]Ít&:t1D$.<$t@D$$ <$ut$a$Y?D$$oD$3}F4$P$Jt&B&<$Иu vF0D$T$4$tGD$D$$o|uuG<$P땋u G<$PB$PDž vF4$PDž^B$PPD$$蛰fi'Ud$]uÞT}Ɖ׋@ rv/lD$$=1ɋ]u}ȉ]Ít&ҋfP$]u}ȉ]ÍP0y9*4$ɍP9#GD$$ӊ늍&PP$T$dPP$T$蠪D8&PxNf]VE$˴Eԅm1uЉ}EƉW v9u9EỦ$E%uً EЃŐt&PD$EE$豉efP$K}E&'Eԅ1 }EUMuЉ/f ɉ }w9}EUȉ$E:EUȉ$E…EĈEET$Ut$$@ɉUnNE4$QUEW&P$PT$PT$@ D$ 舱)^UD$T$$)#t&P9#D$$t&4$蘔$UU$D$$p1dIHt&IHft&21et&@ uRMMHvJE$QEt& UEE& EփHP@$҉Uȉҋuu8]uU@cMA $P1AMuЋ8}tt@u A $PD$$1A $P뵐t&Ud$ȉ}} ]u1NEUy1]u}]Í&E $}tًu tOE1t&D v9u ~,UE$Uuߋ E͐t&M܅u^U;UuUkU@^t&u G<$PD$1$ة%G<$1PUd$ȉ]uþM1҉}E}1҃|(t5utEUMD$ȉ|$$y‹]u}Љ]Ë Ѓ]u}]ÍUE<$Ǎ&'Ud$EU EFUd$EU E&Ud$ȉ]E 'LD$Eu}$tuED$E$SD$D$4$u}҉tJ҉t]u}]fW<$ERE]u}]Ít&]u}1]ÐVE4$RE륍&u͋F4$P1두&UVS?Kd$ED$E $肈1t"ED$t$$|҉td$ [^]ËV4$EREd$ [^]ÐUd$$U EÐt&Ud$$U EÐUWVS莱EKd$ċu}t*UUvt DA u~9mG"v1M U 12d$<[^_]Ít&uՀ0 E vv0tE䋌ҋ91}$EЍv};UIu}9@rs΋E }ԅtM9<}ʐv9<|} 7o"d$<[^_]À0@VUVXtxu|EċuăPMƒ<u U M1 1U tU 2d$<[^_]À0VUVOouĉMt&0tMFEVBbҍvXxOt oNV}ƒ<ο,1EċuăPMƒ<EċuăPMƒ<NVE}ƒ< ο} vE 01*BtbtMsNV}ƒ<οN&UWVSGd$ԋut9U聇U vtDA u-ucv t&11ҋEUD$E D$4$胝Uxـ-Dd$,[^_]=t,m"މtր+t1뢐Ufd$ȉuu ]}LG}vD7]u}]ËED$ D$ED$D$t$<$u]u}]Ðt&US×Fd$ED$ ED$E D$E$d$[]ÐU卤$h]u蔬KF}u}t1]u}]fGEЋD$|$$}蘢tt&tÃ]u}]fVUډ$袧EtM̋}FL$D$<$ỦE|Stt&EtU$r댉<$OE<$< |$D$$Ex}U1u3EMuMY|G9}~IM9pMw׾uGM<$PM}T71Eq RU}~4111ɉU܋E4U؋U(‹EЈI9Mԋ}؋U܃}E1Uȉ}U qMAn f]PUuUY҉UыU܉UЉU IUċuЍ@UĈ7ɉuuߋu܋MEEtu9E`Uȋ}܋EU|$$YsM؉Ɖ $i}<$iU$i}wtpvI}z?LMM؍puuĺ+M6u1MLuuMĈU2@AtHMԍ 9M  M؋uĈU2E9EUM)}1U;Dk}T7D79tNU1T$$i{Dž<<$|tk~ktDM M3uM}E1 6G<$PEEU M R|$Uȉ $ʌt^G<$PUU}E @ 1Mĸ 1 fA u G<$PMv AdEAEȈAU2[UUM}wT UȋUD t}qu*1ɺ)EЋUMЋuGM<$PMUȍt&T$$kT$$#mT$$uT$$譒AtHr3Bt&IT$$fhT$$~UT$$@pBT$$݂/T$$aT$$跀 Ud$؉]E75uu t$@$;x ҉t ]u]fV4$ERE]u] Ud$U]u}u z赛l5GEE;w-EA uqt}JItJ]u}]Ív UCΉȉM$迅Ut6EAEA AA+EAOAƉEԉuuf;e뉐UWVSõ4d$uux$puFD$ PD$T$$gVu FP$R4$Spd$[^_]fUd$$ ]up'4}фƉtz$ 轄}PH) H @PF$vFt]u}]Ëup$ou<$o dƋ]}u]ÐF4$socƋ]}u]ÐU]ÐUd$E]EÐUE]@Ðt&USP3@M []Ð2UD]Ív'UE]ÍUE]@Ðt&UE]ÍUS×2d$싃<u d$1[]f8t$|d$[] Ud$]u臘>2@t ]u]fD$J]u]ÍUS@1d$싃8$Zǃ8ǃ<d$[]Ít&Ud$]uî1Ƌ8u ]u]ft$$ xFH]u]Í&l$蒍ؐ&Ud$]u臗>1u }}"8<]u}]Kt&'Ud$E0UWVS.0d$螕E@D$$͕DEUrut&x\6VtFPU܉$5tNjUt4D$ET$$҉uWE܉<$RE܅yv@$jmUt4EEd$,[^_]ÐU҉UL@$*mӋUB$PfUWVS/d$ԋ@u} P@UD$$詔UBu Mt&tB9pPupLtxL@$lt t3d$,[^_]Ðt&@$rld$,1[^_]Í&F4$Pd$,[^_]ÐU1d$]}5.@u7tF@t]u}]Ív胓F@t@@UWVSܔÓ.d$~@D$$x1WM䍋 MD M܉lj։Eċt#&9Et39twNj;QtTƋuEM؉$69EċMuэt&EĉƋ@$k4$id$L[^_]ÍE܉M؉$M؉뗐UM؉$҉>Ms$躉$觉v'Ud$؉]}藓N-@u7tI8ueZ]u}]É$w9u⋃8$nҍt& $Ud$]u,@u;0t;8u ]u]É$0w9uꋃ8$ڍt& $誈UWVS讒e,d$ԋuFt$PdFu@D$$D= t&Njt@9uVt $/@$-i4$gd$,[^_]Ít&$UU뮍&'UVSæ+d$hut)Nt?@ D$XD$$\XFtF҉?F@tF@҉2FLtFL҉UF(tF(҉(F,tF,҉[F0tF0҉.F4tF4҉F8tF8҉F}1AtuD$E D$ED$E D$ED$D$D$ $4uNjEuCt$E U D$ED$E$t$ lj4$M]u}]Ít&E$]V밍vUS{Çd$܋ED$ED$ED$ ED$E D$ED$$_Vd$$[]US{7d$܋ED$ED$ED$ ED$E D$ED$$Vd$$[]US0{d$܋ED$ED$ ED$E D$ED$D$$Ud$$[] Ud$]uz~}8@1҅t\D$ED$ E D$EA$|$T1҅t!Ut$ T$UT$U$L‰U4$KU]u}Љ]Í'US0zd$܋ED$ ED$E D$ED$$dd$$[]Í&'UWVSyÕd$E E}eU1ҍ u$ :MERl$Q; E4$D$\btnQUMEL$$rƋM҉t#tBlEe3_d$|[^_]ÐA $PҐt&l_M $D$rQUG;@TUD$T$<$Nƅ:M; + $H@@WWUD$T$<$"NƋG<$PvGW@^G EutUD$.$GPDUUk<$D$a$E8EUt 210MMEL$$pED$$p t&MA@WKD$E$aUEԉ$8D$`; +$7EMY $D$`|$V‹jD$EUȉ$k`9; "$}V‹MYUċM{ $D$`; $7Et&U. T$$+oEЅ U$T$oM7 L$$nEȍuډD$ 4$D$ D$HEE4$D$nUQT$M $nu̅4Uă|o4$U-SU}9)‰‰)9}p)D$ 4$>u< }u&vR< t< tEEUM $D$nE4$D$n>Ut4$R| UtMEUL$$mUt\MEUL$$mUr~(bm}U}Mv|$ $m}ED$@ $rmU8MԾMPIv~D$XD$1$\:n&GEfME $D$lƋED$D$lƋUt&Ẻ $D$EĉD$EȉD$EЉD$ EԉD$& D$cGKv3fQECt&B$PmfM~L$$KlOU~T$$/l)B$PEF4$PMAL$$k}uFU4$PUUGU-F4$P EB$PE F4$PFU4$PUU3GUKUSqW d$싃tt d$[]Ít&u鍃C $V;ٍUd$؉]}Gq @}u;8wt$gGt4$f9~t=`$fBi4$R$^4$;]u}]Ðuɐ&Ud$ȉ]up^ }B$B$OƉ|$$]t]u}]f`$btD$|$4$E0UtU$ fUuB$P뙍N E$eE` USoÇ d$썃~$'bd$[]Ð&UWVSoU d$ԋxu d$,[^_]Ë@D$@@$aۤ4$D$k D$3҉u F4$P$U^/ƋUtB$D$mD$D$4$j9OGtfaǃxp]ZYUWfK/4$ORyf$[4$U90FZG@#=~.BR=B5$]p~vpp拃l$NFX$>Fd$,[^_]Ðt&F4$PfP$Ro`t&t4$ HvP$Bt [fu $Qt&'US0md$ [E$i'Ud$ȉ]ulît}t]u}]Ít&E܉D$ED$E$SEl$E} 9G;t @T@t?^<$D$jVU9}G@Tu~ $x,9D$ED$$AQ$O}E܉|$D$E$K^4$d]u}]Ív<$KƋ}뾐1빍t&^vvXD$D$E$.$CafEP$R&}G@TfUWVSkd$$S@{E܍}D$Eĉ|$u4$QMEąD$|$4$PEU $*sE$D D$ ED$ED$GD$D$<$4[҉tEt҉Et҉E܅t ҉t d$L[^_]fE܋P$Rd$L[^_]ÍvD$$vhED$#$ahE܉D$.$Lh&svxvP$R&fEP$R<&EP$R:&F4$Pf $LE܉D$ED$E$Ft&$0>UЍEԉT$D$}؉EĉU<$OEċUD$T$<$NE؅ }ԅAl$@ $2LEЉD$EԉD$E؉$iE $ LE܉D$ED$E$BEU؋t\Uԋt>EЅ҉EЋP$RvEԋP$RfE؋P$RfZ Eԃ E؃t&USpg'd$$9cd$[]Ív'US@gd$܍B$8tD$6FD$ U D$ET$D$$Qt;҉t% @1҅u d$$[]ÐY1ҍd$$[]ËP$RUv̍&'USfGd$ED$$Wd$[]ÍvUWVS^fd$B$7$UEEԋMԍ $ẺD$zS6EM $ D1҃¹tu uu}uEMD$EԉL$D$D$ M ED$L$$W@҉P>11}ȅd$\[^_]ÍvMUJD$E $2uu $U%2[9ƋU $U2Uĉ$ZƋUĉ$@?tD9FM. D$$ZRt&M̋EԉL$$SqWd$\[^_]Íd$\[^_]KWP$R}E NjE$T,92t&M $]> 5t&sZƋE$VFMEL$ D$D$$<[qM $+vF4$PfMԉ4$L$L$mGtUu*҉VEĉ4$RE&MV ƍD$XD$$){E $q?D$M̋EԉL$$Q#x+EF4$PEw3F4$P v'USPbd$ED$E D$ED$ $$[d$ԋxp>1$7R$*HErYFjYF`D$$$9Ft~D$$tQ$9F tV$v#FD$, D$F $ Rtd/u d$,[^_]H<$s$E$XG<$1+4$%d$,[^_]Ív$Ot&vS/t띐t&D$$1/nsv4$t&$SUd$$D$ D$]utY+f.9]LƋuN‰]Ðt&UWVS>Yd$ċxuǃxkfIQ<'<$5EE$ FL7Jf vQWGCWGLU$7G^,.$f7G D$$L$ !GD$, D$G $X;C02D$$K`D$$K:PE?Z)Qlt&U<$T$8|61EEEED$$8$0SE$ۤD$8$kAt 81E$D$g8U܉$,EUDD։EEEЉỦEЋU $EۤE܉D$EC>$U؉T$ uvt`4$~"tEUB9tT$$~8t!EԋỦD$ET$$Mat $XU܉ET$E؋UD$$,Zut`4$!tEUB9tT$$7t!EԋUD$ET$$LtR $ƋU܋E؉T$D$4$utl$UG!UtKF9tUȉL$$D7Ut$EԉUȉD$ED$4$DLU9tEЅtU$t*t&d$<[^_]Í&4 $t 8-p@ $]t 8 KN $8t 8&] $t 8u $8L‹F&$IE$I$|I&D$$ CD$$xC#6$yM~$E҉oP$Ra6 $i8`$N$D$:EEt @Eԋ8GEEE‹7f‹Df‹fh‹fB$PTfF4$PfF4$Pf$;4$EMUȉƋB$Pv $Gt& $GUf $jGt&lEȉ$OGE&$2Gt&$GG fEȉ$FE&$FGft$Ft&H$Ft&4$F"t&0uYEECU>CCUUE{RC$$m%t 4C1t&S>$K USO×d$$d$[]ÐUWVSOed$ԋu u 1d$,[^_]fC-D$$EE<$)E} -E)ƅ~\<Et$|$$"}8t݋E$;)$kJE$7SE$)E$60TD$$!rD$|$DE$(D$t$$!T&UWVS>Nd$ċ0LD$$gDE%@Eԉt$|$$ }0S 8tލ$C}ԉ<$5d$<[^_]Ít&t)ƅ~<뫋@@d$<[^_]Íu $AL8C.UED$ T$$+ƋE8u 8"ufu$Bt@1@t&iCÞ&@u"$B@׉Ud$}} ]uqL(G Uwu]uv<D$D$$d&]u}]ÍvGfU+UtVD$$_A밍CD$$$>Af뉐B@W;$:V!Ѓu u΍1]u}]Ð$9!ЃVt1ډ$)t1ǐt&$h+f=vD$bt&$p2nY1c$t&C21f$1 $*&>1]u}]Ít&9B(;PU1#v$U]H0=U$D$pPf$U H]=PpD$D$$F/1 &$)=fD$H말$x)=D$ u&$@)=tD$k7B@W$UUux$ 1t&Gtx ҉P$R1Dt&$(‰V뵍t&,\uD$0$=t&1F&v&#v]fEt&f1Nft&1 lt&UWVSFõd$ċ} 7u `7tWE4$D$AuuԋGE؋GE܋G EED$EԉD$EE$#d$<[^_]ÍED$0$EċUt~51U$D$Eĉ|$$H:U9R|t*UċgUċB$PE%Eĉ$M(UVSBæ$EeU1ҋP,T$PRT$@D$4$@D$ <D$w4$/Ue3u $0[^]t&'UVS_Bd$uFF8t҉Ft ҉trF t ҉tPFt ҉t.Ft҉u FP$R4$4d$[^]ËFP$RfF P$RfFP$RfFP$R[&USA7d$E D$E@ $@!1t B d$[]UVS?Ad$E $1t$Et$@ $ t3҉t d$ [^]Ðt&V4$EREd$ [^]ÐT$XE$K6E뮍&'UVS@Vd$uF t ҉t/Ft҉u FP$R4$d$[^]ÐF P$RÍv'UWVS,@d$ԉU@Et-D$F$%,1UV_E $HU܉$NjUlp8P@4UP@ @@>G $:G$:GW(EGG G$W(G0G4EG,FtH$tsG$وW(|$GD$F $8<~;EtZUtUFD$B$*d$,[^_]ÍvHuG$넋FP$R&F@ F뛐t&u G<$Pt&F1d$,[^_]Í $H U卤$uƉ}]eE1~=ØF V(dEʃt{iFL$D$ D$D$,<$J |$$2F0D$F8$1tKuUe3uH]u}]fFL$D$ k&FL$D$ K2fUWVStB~<1v;7}1D8uPE$>ufd$ 1^_]Íd$ ^_]Ít&'U卤$}lj]u7öeE1WB4B4D$ 4$ D$D$4$et7‰$t#҉uF4$Pv1Ue3u ]u}]Ud$D$D$T$]u37Ɖ}ED$ UD$$x]u}]Í&$. 1ɋUt׋T$$O,F@,D$$1 Ud$ȉ]u}Ez~65WD$.$UU)Љ$D$ƋUtKG:uSB:uGUBxtq@,$EuS1]u}]Ðt&E$҉uҋVE4$REvUBH ҉uF4$P]u}]Ív/:F4$P1^UWVS>5d$EUE3E3i|3Eil3E\3EExUME܉UME }MMUET$UMD$ L$B $Eu@U$D$t$<$E1UEU D$t$$V1x:MVMt$ $?Et$$(}EEu@G<$P5&EEEEEtt ts}tUutMtUMtUtPUątMċu A $PEd$|[^_]ÍF4$P낐t&A $P렐t&B$P륐t&B$PhfUMt$ $c$D$t$<$E/U :E H(MT$t$ $j/qEt&}D$D$$ MA,D$A8$ EEE eE t$$vN$D$t$<$E.Ux B$Pv}iB$P[$mTE!u1REVEU1mvJ1Ut&TED1t9|݋u~1vv1t9TEu1EXVEU~1 v1t9LTEQu1BxEW Ft$D$E$OUB1ҀH(E8E&Ou1t&TE|<1t9|݋uNTEt1t9|݋uEVE}$RtEqUBH(B@( D$$PUFD$$1t&RE ~ 1 v1t9TEYu1RE=N1uTE1t9|݋u11~ ΅tt&9DPEW1vu֍t&uFD$Et$$mVEtQVE{\E1uVtEPVWuE1$‰1$‰ 1dv'UWV֍d$Eud$1^_]Ðt&VEt~1fTEtɍv1t9|d$^_]Ít&UWV֍d$EtstNtd$^_]Ít&Rt E!tuVt EtbV uv뽍REd$^_]Ðt&z1TEdtv1t9|kt&d$1^_]Í&'UWVS!A$eE1:v$Ue3 $L[^_]ÍvpvR&뽍t&B@DžeT$ D$$D$B$K$k1t9||$F$=tD$F@ $Xe $8 MWT$ RFH0u WP0FWH WjW BfB1ɉΉT)v1t9|ڋFP p0WP0t&B1ɉΉT9v1t9|놋RWfv'vB1ɉΉTtMv1t9|ދO1 &1t9Tuf1B1ɉΉTQt͍v1t9|ދ1ɉ΋G t&Ttv1t9|ދDž1t9tVt;#Vt! ~ 1fTqv1t9|ڃaRiW*vGvRWtG 1ɉΉt&TAv1t9|ڋO1 9>Tvu1vRW B1ɉΉTv1t9|ڋWYRv^G1ɉΉ!&T)v1t9|ڋO 11 9>T^u1vRG1ɉΉ!&Tv1t9|ڋO 9 1 9>Tu1v)!W'Ot!WO 11t9qT6u1\vJ11t91Tu1vR fNFH( F@(D$$GD$$g1R$GG1ɉΉTv1t9|ڋG-#1ɉlj v97T~u1vR$GG@ 1ɉΉvv97Tu1vRtO1v1t9aTu1LvB$PGtH~B1ɉΉv97~TJu1GWD$|$$W%G 1ɉΉ TAv1t9|ڋ9H +GWD$|$$2JV1ɉGFG Ήt&Tt)v1t9|ދFFO1y31]'&UWVSed$$(' @ $F#F FF FE EF$+ED$D$$FF@ U+wqXU>It}>lF1҉L$M<$X҉Mtz҉tWt=d$,[^_]ÃutD$$ U4$1d$,[^_]ÐQE܉ $RE똍&WE܉<$RMEo $‰뚋EPvU1JuTE tP1t9|uE1HuTEt1t9|ƍ&uG<$P۬@U@$D ]É'@U@ D ]É'USwd$싃t$Ad$[]f d$[]US7d$싃@@P 1tE$D$d$[]ÍvUS@d$싃$d$[]ÍUSǫd$싃@1tB@$$id$[]Ív'USÇd$싃@HE=t&@v E~+uD$$1vd$ [^]ÅtՃd$ [^] US Çd$܍ED$$D$E $1tE~$r d$$[]fD$$1ٍv'UWV1SL d$} t5vu틳 9tCZ|$$)d$[^_]Ív$$tቄ믍t&D$$빍v'US gd$M UD A8T$U $T$Ut!1Ƀ҉u P$R1ɍd$[]D$$dܐt&US0 d$܍ED$8D$E $Iu 1d$$[]Ít&E$u䋃 ۍUVS Æd$ED$ED$TD$ MD$ED$E E$$m E@$E@;%$$T${UD$T$$ƅUB@U@tvt $Ѕtc 4$D$1҉u8VE4$RE't&$  11d$@[^]Íd$@[^]ÍE@@ D$ D$$$Mt$$tIEE됍@$mn$$wU'USÇd$p$8d$[]É'USWd$$(d$[]É'USp'd$̍ED$?D$E ED$ D$$tED$$d$41[]ÍUS÷d$̍ED$ED$ED$ D$E D$ D$$ 1t"ED$ED$E$ d$4[]fUd$ȉ]uw.`D$@}u @@$ 9u]u}]Ít&pT$ED$<$Utt]u}1],u荃 $:UD$D$4$UEMu $D$.uEt$D$<$UwtY~ED$:<$uD$<$렋Utj$Et&ED$ $u'Uu B$Pd$,[^_]Í&$ɋB$P닐Ud$uu}} FtU$T$ׅuV 1t E$D$׋u}]Í&UVd$uFtF҉t,F tF ҉u P$Rd$^]ÍvP$Rɐt&Ud$؉]u~u}4$r1U@Ft ҉tfF t ҉tD4$蔵t~E]u}]É4$蘷]u}]ÍvF P$RfFP$Rf봉'Ud$ȉ]uî@}U8w0t39Ft(D$Y$]u}]Åtԋ9BuɋU$XUɸtŅtgqQ Bu:1RuutG9E}#vtt&d$,[^_]Í&F @@4$菥F V@@0U܉M$sU܋M$‹E L$4v{돍&$`E2d$,1[^_]fD$$Rd$,[^_]Ð}UPۤ]Ud$]u>}}u8P:;}]u}]Í:U䉳BvtɃJdtcXtXE|$$ɬx:u> P9E_m&D$XD$f_$J]u}]ÍvE E8-ƃxP-H:QHP:H:fG|$ D$XD$_$蝨0ۤuM 4@1]|$ 띋M䍃S $D$UUu:h#ZD$EU܉$eU:VUWVS>zd$}u t%wv;t+d$ [^_]Í&U1WVSÃzd$u}U taUU܍&v~2EEE9Eu1}t0}Ru4E+Ed$[^_]fuE4U卤$eE1]}y}E<$uݝXuDd?%t&1ue351]u}]Ðt&GOuv|$PD$0<$+VNtEHD8HDR tDGu.DždX1ыdD9E T$)ЉHDD$Љ$jXH|$D$$ηyd- RDGDždXCdgdZdnNet&tEt@u>y'UWVSåsd$E觛 $MڷEЋuM &v< t< t< t< t< t< t&t<- <+EPЈUԀ v(<.t8^&~;H w1` tEԉR)ЃU~#u REUEȅEEčE؉$E'uEE)ƒv 8.)ǃ@UEs9FJ߃^@ ҉D$ T$D$1$XvE)ƒB809ME0uE=@EUf>v ^M̋EȉRU)@EE܉$E Et&D$ T$ /t&D$1$|&RM̉U)Uԋ~ ҉}@~WEЅg}=<E܅x9OE؉}ąx9MljEċE$D$(@ EẼ>^1E1ҋMUD$ED$ $v;}ċUMȸ Dȃt~}0} @9u}E)9‰E}EEċE)Ѕ|1ҋ}Đt& R9ucU)UMU)U0[D$1$!lݐUWV֍d$U@@@ @@@@J+ -}upW xp >MM 9~hM))+U+U It}^}=H UMPMM Mup d$^_]ÍH UMP͉@-T+PEt&--@DֈP"f@@-H UxPpMd&P UMPJt&)ʉMUP P'fPMH Mt&UWVSeid$ĉE؉Uԋ9PЀ 0E1Et&E؋u܍IE9Mv PЀ vE0Ed$<[^_]Í0Exލ<vG EgfffmE)9tD$$&EEd$<[^_]E1UW<V)Snhd$uEFFFF FU V}Љ‰M?HLFU)ЉUE,&>EԉFU)шUMċMą~@P w5ҋ"tFEP)хɉU~@<#u FEuE)…~ 80EEԍF $EuF E9t 8.NjE)uFd$L[^_]ÍD$$~d$L1[^_]Ívet&^t&t&<^&v@EF$E"t&}P~0uF=EfS'Ud$ȉuE]}Ew.ftU4$D$T$訙7txGuYGtU4$D$T$~wU tXG tMD$L$$U]u}]ÍD$E4$D$mwGvzfGR띐t&UWVSce$eU1N~VBFf$Dʈֲ.%ۤHf D$|$ ;!}ݝD$D$<$Ě݅X\$ $|$D$x芣 T$ $D$xʋ:R!%tljDǍzEX)π-uY4҉t$|$$T$D$֚tp ҉EƍqD$|$$3|$D$H4<Ɖ4$1 ؍Ue3$[^_]f݃gA؋|ƅf'X D$$设1fݝw1Ʌ݅_Ut&Ud$U]Îb҉u}uu4$k]u}]ÍE D$}Љ<$1tE1<^EET$UMvt$D$蚞U;UċMuЉ Dt!G$D$ED$蜎MUE)9)ȋMD$T Tt$$gyD$1$膶XM)щM9M)щM#@D$$CUWVSUZ$TEU`d`D$/$eE1u  t$ .$D$D$\$d#d$D$|$T$b҉tplh |X1fR;t@}Rp13p uድhl3p 3H uˋ\D$XD$L&t@t| $(,@@p$huu`t$$[dt ~.\$T$蜖Ue3$[^_]Í R0뽍v`t$D$9$$j`D$ D$$$<$D$`}L$D‰D$p$~1KJU]Ð胾WU0u ǁ0]ÍS[WU,]Ív'Ud$eE1uu]}fWu#ǃ,Ue3u]u}]Áw 茖}<$ɖut$<$َE<$Uulj,1뜐t&US×Vd$E$ڮtm$$d$[]É'UWVS螼UVd$ԋ}u v<$Іtuu<$ʁu|ttu1d$,[^_]à tt捓$E$VEАv$E$?EfUWVSõUd$䋃 uD$$$褺t 9pt!Nju $賒d$[^_]f$\fUd$uu]脻;Ut4$u4$%]u]Ív$$zUd$]u7T0t>$芥tD$D$$謷u]u]Ít&c뻐$$4$1舐]u]Ít&US谺gTd$ t((d$[]Ðt& ؍t&'US`Td$싓0u#t$ v$,t&d$[]É'Ud$롐U1d$딍t&USçSd$싋0uVEEd$[]ÍUWVS讹eSd$~ ƅt/- $t;pt$)ud$[^_]fԍUWVS>Rd$u Nj D$$$t)$ t9pu;xu$蠎 $ҏd$[^_]ÐUWVS輸sRd$ԉU艔 1tsD$$[$$1ɉU$U܉t&9;$t6tP;xu9Pu܋ E؉$+E؍d$,[^_]Í&E܉U؉$U؅u&1Ut$QtxpUP $$념EU؉$袭URfU1҉d$E1tB fUd$U EÍ&Ud$eU1҉]E KQ0}ɉu}Eu4$ϐuR,tD$4$ՈuyD$4$aE|$D$ t$E$wlj4$ݫt1Ue3u?]u}]Ív#tE$MEĉ4$萫܏UVS]Pd$$Zt:/ut&</tud$[^]Ðt&USOd$UD$T$$~1uE%=d$t[]Ít&Ud$ȉ]u}E豵hO1:/t$詓ƅuS<$蛓v )u|$4$UD$UE]u}]Í&U|2/u=v %$댍&w2/vqUd$؉]u}ÙN:/tD$E‰D$#]u}] UWVS莳EM$4DždeE1{h<&$2}D觋$D$/l|Dl2D$tpL$$w}2t</t0lDL$<$p<$D$D]t$<$џd<$T$迟h<$L$譟@\`g`\``"7","!"Ee3H$0[^_]ÉH002tp`\ f_V$D$:DvƋD)п=T$pD$ F$|$qƄ2l\`tD$T$$)uaGIh:f6&$*vd& dt&lY&D$D$$v`9Y&D$hD$$SvB D$lD$$xvh D$D$ $Pv%D$XD$$qX%D$D$$q&D$D$$qX@ fpD$T$ $fu'`D$tl$t$芐G&ttv`t A&p`׉\Xt&pv!%tDVD`+p9\,wƄ3`p`ulX$Y&D$|$9t lA&l HflD$ $|$s lulD$pT$$sƅDž\p|$ $D$|s\ҍ^&Njpp$ІƄ2Ƅ6"D$hXt$$jG&hhV(hah PT`Ks&ljLv!%tDVDPTLT`|$L$$cp)u%=@rTƄ3""XXY&KD$t$$q Xws&Xf`hT$L$$ou%=@Hu"p%D$XD$$vmXt$D$$d$@t2d$[]Í;2d$[]Í&'US谤g>d$@t"d$[]Í"d$[]Í&'US`>d$@t`d$[]Í`d$[]Í&'US=d$@t d$[]Ít&S@d$[]ÐU肤=勑BEE B]Ív'Ud$ȉ]u藣N=}tOX8dT$ <$D$D$j&<$D$D$i]u}]Ël8dT$ <$D$D$ih|$$`bl|$$Nbp|$$i||$$a]u}]Ðt&UWVS^<d$ԉEU3$诔34$D$3ED$ED$3$荋D$D$<$EUɉɉta ɉ t>1҃ɉtd$,[^_]ÍP$R1ҍd$,[^_]fJE؉$QE뱍&OE؉U܉<$QU܋E눐NE؉U܉4$QU܋Eb'D$XD$$gtCt#d$,[^_]ÉE U܋EG<$PfF4$P벍&D$XD$$3g&D$XD$$g`F4$P UWVS9$$,UM EBBL\3ttM ET$L$$ut'ct"mtEtRu˃ƍ뻍vu8y͏蘓aDždDžhDžpDž`DžltU MD$T$ $tGcm@̓Ev!M :ƍ$[^_]f$4t&h념t&lDždjf\ZfJftx1"f4f$`mvht&ffDž`&&9ʉDH:&H:NuyH:Nup_&Jfppudt [kE<$D$<$tpt|菈$[^_]eT~TD$ T$X3D$D$T$`ҋThlPDžp $w$P‰$TD$|T$wTf pDžtE 1ƍ$[^_]Ë$rw$ǃtk1T$${|tlpuutkt,ED$D$ 3D$$:),$W$urF$ B$Pt}ttƉ $m,D$ D$D$$譁lD$ D$D$$腁XD$ D$D$$]D$ 3D$XD$1$:^,D$ D$D$$lD$ D$D$$Հ|P9DPuP:Q'D$XD$$]t&$`8t $`8t$Y`8Dll3$)`8A:R'D$D$ D$$\l0pp$Tr$TƋT9F $UTT$D$$OTu F4$P1ҍB\P:Q@:APM t'T$躊TvL'T$蛊Tpt8ui3$^^tU8tP4$D$a%$TED$D$ t$&nAT$n1蜈t|3EEpD$ 1pT$\D$$= u B$Ptu F4$PhtvӁ蔆p $D$`\`u8\$BRD$U$T$苆t?t&\$Zbt u苍\$ L$f똋E%=@uU pL$D$D$ X(D$X$?Y\ $mRƋ$TU D$D$pD$D$D$ ,(D$X$XBQ‰T4P$uTP t$$W(t8 UVd$uF@U@t#t 4$ЅtvF~@Fd$1^]Ud$uu}} F@U@t"t 4$ЅtFPt0tu}1]ÍVHJWPG~@1u}]Ít&Ud$uu}} F@U@tt 4$Ѕt Fxtu}1]Ít&VHJWPG~@1u}]Í#+* ǁ U]Í') ǁ U]Í'UVU uJ~19r u9t t@9|1^]Í^]UVEPztJBp1HRQ@^]Í&'US萏G)d$E$:Zd$[]Ít&'Ud$U]uT )BxtHr1JpqB+~ R+$A]u] USç(d$E$Xd$[]Ít&'Ud$U]uu 豎h(BH@ƍD=w(@ RD$$螅t@ p]u]fX]u]ÐUd$؉}}u]A'w~t}l$dFWRV2p]u}]Í'US×'d$E$:d$[]Ít&'US谍g'd$P;tBBUu1;t"d$[]Ð1Ƀd$[]Ív$Wҍt&B$T$6e1Ʌ볐t&US0&d$ED$E $3yd$[]ÐUd$ȉ]uî&ƋB}t 9Jt6t T$ B@ t$D$<5$p]u}]Ðt&BH>t yGWuD$T$ 6t$$=p빍vU $}MUUVSO&d$Btz}OD$T$$pPtR@9tT$$Ant-4$usuF]4$PEd$ [^]Ív׍t&~vd$ [^]Í&'UWVS螋U%d$ԋU U$EUtlB~e1Et&| G@U@t@tU܉<$хUt'G@\tMU܉L$ML$<$ЅUuv9rEd$,[^_]Í&UtEEd$,[^_]ËMA $PߐUWVS辊u$d$$+0E؉EEMuu؍ E܋09ttM&69uta~ G9@\t9} tM UԉL$ML$<$ЅUtʉ$|$>vUyt11ҍd$L[^_]Í&EE}ed$L[^_]ËB$P1čUWVS辉u#d$$t]+EE؉E܋UU؍EE܋09ut#t&F 9tD$<$}uu!69uuEE}ud$,[^_]Ðt 1d$,[^_]ËG<$1Pt&'UWVSõ"$dBEB_+]uuDu+1M@9R}ME1҉} M4uu t89}tML9O}Mpt9}>tRH;U@uu}}u(M+9vP P9u}+9iEG MPD$L$$R\?9uߋU}܉}}}܍+9tfM.&W9PUW}:UGt/NjWtҍG PR\GMt$L$$ҋ9u9utBM+9t}OH+G8U++u;uMЉMMԉMu gt&F >t!VPEԉFuԉ0EF;}uʋu;ut/P}}F MP|$L$$R\69uu;u[5E}1 v6;utBtV E6;uu}E}܍u9ljuuȉuĉ}=vUM MB@T@tMxh~F<:7t=4$vF tFxtVHJUȉPEȉEF7uËU9Uu};}Etat&w V D$$Ut$QU8҉E9E;}uuuuu;utJvB ~ G@`<$ЋE9z;uuu;u*Y5B1U f6;uttV Eg6;uBug}}BuЅ;;ut:B ~ u mtB|$$/px+6;uűE;EtMQPEԉAuuԉuЃ}6AYt$B$G^7$yE$[^_]fF4$PE9uWPMAGy8EĉWP$R)fB|$$^o~PP}GFw0>FG<$PGf$]t&Mg5ݝx$f݅xEEztv؍E$HfE+D$16$&f7$fT5}UU 19t vR9uMvT$ $eEu]Q$e"U4U<}M07ݝxM|$L$${e݅x\vqMLzt&#NM\B1M܉MMM9}E}}ȉ}s$ABB6$w/$\|B`7$vv5$j]Bፃp5\$${d .&Ud$E]臀>=u@ $g@++9Љ+ F ]u]Ë tt勃BuUuҋ+;+ǃB>+;+.+;+ǃB뎍vI]u]1ِ&Ud$؉uu]}} EFVǍD$Qt xp]u}]Ív'Ud$]u7uF$bQt p]u]ÍvU1S~õd$BuǃBǃBd$[] US~gd$E $gRd$[]Ð&UVS~6d$ D$D$D$ +D$%$oBD$4$5D$=B5D$D$4$qP5D$D$4$OP5D$D$4$-Pxy5D$D$4$Px[5D$D$4$Ox=5D$ D$4$Ox5D$>D$4$Ot&d$ [^]$lxB܍t&}O$*DBov'US|wd$̍ED$,D$ >D$ED$E E$T1tEwAB1҅t$md$4[]ÍǃB9ǃB΍v6D$$q1뵍v'US|÷d$싃+D$ +D$+D$6$Yed$[]Ív'US{gd$싃+D$ +D$+D$6$ ed$[]Ív'US`{d$싃BD$}$dd$[]Í&'US {d$܍+PD$(T$ D$6D$E $(O1t d$$[]Ð&USzwd$썃BD$06D$E $N1t d$[]ÍUSpz'd$싃 $gCd$[]ÐUWVd$u} F tU$T$ׅu,FtU$T$ׅuV1t E$D$׍d$^_]ÍUVd$uF tF ҉tTFtF҉t+FtF҉u P$Rd$1^]ËP$Rʐt&P$R롍'Ud$]uGy}`<4$>,D$D$D$ @=D$8$j$XED$7D$$dBD$]$D$E$C9@-?>D$7D$E$98t$D$<$,8x[]u}]Í&'US0xd$UBt Bd$[]ÍyD$0$m1ې&USw×d$E D$ED$=$Hd$[]Ív'Ud$D$]uwFuF$JvuF$kN ]u]ËF$MN7D$B$l]u1]ÐUd$D$]uwuF$uu$?]u]ËF$M$?]u]Í&UVSvfd$ED$7D$E E$J1t24TƋED$E@$-uE4$PE$W?d$ [^]Í&Ud$uu]$vFt&D$$tF$LF$`D4$h]u]ÍUVSuÆd$ED$7D$E E$I1t+Ex2]HƋE$pSt[t64$fd$ [^]ÍL9D$$j1fp9D$B$j1붍t&ED$7D$$?H1덍vUStçd$Pt$SRd$[]Ít&8D$B$@j1ٍt&UStWd$r d$[]Ð&USpt'd$싃$`d$1[]Ít&Ud$]u7t >$"C1tD‰F҉t ]u]Ët%*8D$B$mi]u1]ÐF4$PЍ'UVSsf d$ЍED$ED$ED$>8D$E ED$ D$$51u d$0[^]ÍvE$oE@@WEt @@W $}]t@U@VUVUV $ ?FtIEEEtLt$$otg$Pd$0[^]Í&4$HH<#O8D$$$g1&j8֍9΍8D$B$gUtTUt8Et҉u EP$RF$#<4$G1yEP$R뺋EP$RUWVSqe d$u~xMGP<$G<$OF D$FD$F$ <҉}Vt_VtAF t҉u F P$R4$F<$K;GAgd$[^_]ËFP$RfFP$RfP$Ruf$Fu\9$vT $0tFD$D$F$mFQ$?T$Cl scXD$D$F$3밐t&UWVSp d$u};u.M tE $<t<$;4$D$U tE E F t~F8t$$jLFmFt{WtQVT$VT$$lxXd$[^_]Ðt&9D$$1$dd$[^_]Í:D$$d&t 1d$[^_]ËF4$1P냍t&'Ud$]un^}EUVEԋUtsBUD$Eԉ$VNƋUtsNjr9ttBtz]u}]Í&FU4$PUэ&:D$1$culNjUu뢋MԉD$B $D$"kUttBEtBɉtrBz;EtBMD$B D$$UхUBD$Eԉ$hRGM܉<$PM܋UjHU$QUzUd$]umþu>¸tE4$D$E D$B]u]ÍvUd$؉]ulnu}} 1t`<9Ft|$4$L]u}]Ít&|$$DLtӃ]u}]Ð&UWVS>ld$}wtyDJtR@tK$!_t=vF@t%W$T$KtGD$F@$P4$[uƋGt҉u GP$R<$G<$d$[^_]ÐUS{k2UXEHщXE[]Ðt&USPkd$Cu d$1[]f G;BuǃCd$[]Ðt&USk÷d$gFB,B56@Nd$[]ÐUWVSjpd$ԋBD$$ZǃBCAt|  pDŽC@t2t; t*;Et; EtUD$<$EZUtuFU4$PAUuEt ҉teEǃEt ҉t; EǃEt҉u P$Rǃ Ed$,[^_]ËP$R뺋P$R돍&'US`id$싃 ǃBǃCD$$;6d$[]ÍUd$ȉ]uiþB}u1]u}]Ít&D;BuǃB*D 9:ME䍃CE t&vAt<CtMEL$t$$QDŽCtZMD$D$D9U؉$2U؋ ɉ tt*҉uP$RvJE؉$QEҸt&'USg×d$Td$[]ÐUWVSgud$CBc)BD$?D$ D$@LD$<$X[ ${FE$ -E6 D$>:D$E$' $, E MD$ $F:D$' $AVD D$N:D$E$S'  MS: $D$SEq CǃCE䋻 #O E|vAt;4$DDŽCuŋEMvDAuʐt&C;Ec $ZCƋMD$ $g:D$_&t $ CƉD$n:D$E$%&t $BƋMD$ $u:D$%t $BƉD$}:D$E$%t; $rBƋMD$ $:D$w%t $8BƉD$:D$E$=%t $AƋMD$ $:D$%t] $AƉD$:D$E$$t $ AƋMD$ $:D$$t$PAƉD$:D$E$U$t$ AƋMD$ $:D$$t5$@ƉD$:D$E$#t$ @ƋMD$ $:D$#t$h@ƉD$:D$E$m#tW$.@ƋMD$ $:D$3#t $ ?ƉD$:D$E$"t$ ?ƋMD$ $:D$"ty$?ƉD$:D$E$"t/$F?ƋMD$ $:D$K"t$ ?ƉD$:D$E$"t$>ƋMD$ $:D$!tQ$>ƉD$;D$E$!t$^>ƋMD$ $ ;D$c!t$$>ƉD$;D$E$)!ts$=ƋMD$ $;D$ t)$=ƉD$$;D$E$ t$v=ƋMD$ $,;D${ t$<=ƉD$4;D$E$A tK$=ƋMD$ $<;D$ t$<ƉD$D;D$E$t$<ƋMD$ $N;D$tm$T<ƉD$V;D$E$Yt#$<ƋMD$ $^;D$t7-$;ƉD$f;D$E$tZ$;ƋMD$ $o;D$tH$LƉD$x;D$E$o$LƋMD$ $;D$9$NLƉD$;D$E$|D$D$;$BIEtMD$ $;D$z2fd$<[^_]Í&M䋃 EDF4$P(1u]u}]ÐEE$uEЉ$}E|$t$$D!u]u}]Ít&E$N1됍&'USpS'd$܍ED$)D$*1u]u}]Ðt&E$NjE$$G|$EPED$ED$ >D$Eԉ$UЉD$UЉ$#uG|$F D$F$;u"t7 ]u}]Ðs1␋t(1G<$P뾐t&G<$Pؐt&CUd$]E=îD$ ED$>D$E u}$u1]u}]Í&EPBWtT$\+ƉuJ‹Et$Uԉ|$$'ƋUԉ$x" 뒍$lj맋$81dUd$]E=D$ED$ ED$&>D$E u}EE$1u ]u}]{ƋE܉EЉEЉD$ E$D$EUԉD$lj4$x ]u}]ÍC댐Ud$ȉ]EG<D$ ED$1>D$E u}E$1u]u}]ÍƋED$E$lj4$x ]u}]Ív릉'Ud$ȉ]u;N}HƍE$2lj4$u-ED$ED$<>$9]u}]Ít&#]u}]ÍUS ;d$܍ED$A>D$E $1tE$$d$$[] UWV1S:sd$EE܉D$ED$ ED$J>D$E E$wE$tƒQDЉ$$4E4$D$}4$*EԀ>atpEt$$NjEԉ$$4$ <$D$ ED$O>D$A7tE܉4$D$d$L[^_]ÐED$$].rUЉD$ED$$5.Et$$fNjUJET$D$$..t&4$1m`t&31Pt&Ud$]u8ÞƋE}$UMNjMtMu| D]u}]ËE 1EEЉUm܋S$ MfUWVSl8#d$ԍ@E$#F$G V\FXT$$ )GVT$$(GF$GF$yGF$G V0F,T$$(G$FTEFDD$F@NL$MFHM$L$E D$FP$F4$G@F8$GDF $GH ud$,[^_]Ít 1d$,[^_]ËG<$1Pt&'U卤$X]E6ëD$X>D$E u}$1u]u}]ÐsNjEuD$t$$*t<$tu]u}]ÍvK]u}]Í&'Ud$]E76D$`>D$E u}u$t$ 1u]u}]Ðt&NjED$ED$E$@E<$4$/Ex$']u}]Ð뗐Ud$ȉ]E5>D$ ED$j>D$E u}$Zt&Ey/']u}]f]u}1]ÐD$$t܉EƋE܋}$D$E|$$lj4$x#9}tE܉|$$*Ex&U܋u E܋P$RyMt&Ud$]Ew4.D$E܉D$ ED$r>D$E u}$Cu1]u}]ËEE܋PBWtg$!EЉUd uƋED$ EЋUԉD$ET$$)Ủlj4$ U̅xY<$T$$gt&$‰EU뒍vEit&EYt&EI?v'Ud$ȉ]E73D$ ED$|>D$E u}$ 1u]u}]Ðt&ƋED$E$7 lj4$ x ]u}]Ív말Ud$؉]E2ND$>D$E u$t1u ]u]fƋE$ E4$s Ex$]u]f 뵉'Ud$ȉ]E2þD$ ED$>D$E u}$1u]u}]Ðt&{u;u}4$v9u<$ ]u}]Ív'Ud$ȉ]Eg1D$>D$E u}$A1u]u}]Ít&ƋE$6lj4$< x ]u}]f밐Ud$؉D$]u0ÊƋ}$lj4$]u}]ÍUWVS0Cd$ԅ҉U~1$9}4$d$,[^_]ÍUd$ȉ]M70L$ u}E T$L$$1u]u}]f ƋE$Ulj4$ x"E$ ]u}]ÐE맍&'C0KU>d$tEE &0U>d$$EE /U>d$EE /U>d$EE Ud$]u.~}uEE t$T$L$uL$t$ $1u ]u}]+ ƋED$E$Ulj4$E$tE$iu ]u}]Í&딉'.U>d$EE .U>d$(EE S.[U>d$EE U卤$X]Ed-D$ }uE1$D$ED$/u]u}]Ít&u} ‹E䉕t|$$U tt$tu"[lj4$]u}]ft$$ϐ&US,Gd$싃D$U >$ED$ D$d$[]Ð&US@,d$싃TD$U >$ED$ D$d$[]Ð&Ud$]E+ÞD$ED$ED$ u}EED$>D$E $1u]u}]Ít&; ƋE܉D$ED$E$!lj4$x"E$w<$]u}]fE@땍&'US+d$܍ED$ ED$?D$E $1u d$$[]ÍvED$E$x d$$[]flj'US*Gd$܍ED$ ?D$E $i1u d$$[]fE$x$d$$[]fЉ'US *d$܍ED$ ED$?D$E $1u d$$[]ÍvED$E$x d$$[]flj'US)Wd$x d$[]Ít&d$[]Ut&US`)d$܍ED$$?D$E $91u d$$[]fE$}'x$d$$[]fЉ'UVS(æd$ED$ ED$-?D$E E$1u d$ [^]fcƋED$ED$E$( E4$Et-u$D$t$8?$&d$ [^]Ít&+돉'UWVS,(d$ăUU EU$NjU@B݃S$] G UBB E$GUB$$GUB$GUB$GUB$G UB $G$UB$$G(UB($G,UB,$G0UB0$G4UB4$G8UB8$zG]u}]Ít>1]u}]Ít&QD$$N>1]u}]Ðt&USWd$ $d$[]É'USp'd$$d$[]É'US@d$ $d$[]É'USǴd$$xd$[]É'UWVSÏ$D$$T$NjtW~M1fJ v9~q$&uډ1;t$I$,[^_]Ív8t,Ǎ$,[^_]Í&뭍D$$\t$tbD$$<$4,t&G<$1PUSDzd$$d$[]É'US×d$$Hd$[]É'USgd$ $xd$[]É'Ud$ȉ]uw.}EED$ D$D$$~u8}4$D$|$?$]u}]Ðt& t&y D$$h 1t&v봍&'USgd$̍ED$D$D$ ED$$+u'ED$ED$<>$d$4[]Ít&3d$4[]ÍUd$]u'ް;f u4$]u]Ðt&yߍ D$$` 1ɍt&]u]fUWVESb$tD$ED$ED$ D$?D$E $jUB@T$EEċE܉$E=kEЉ$hEM}1RUv9uEUċ9t$$ҋM|$$T$ UT$`uEE$$1[^_]ÐQD$$$ E$s$1[^_]Ðt&$EE܉Mĉ$Q럐EME܉$Eu@=?EЉ$,":D$ED$$EčD$ED$$EEnuącUċB@WMA@WM-E؍pRER>1UME}SElj$hEԋMD$E؉$UD$ L$|$EUv9uUĉt$$MEt$ $IU>EUMD$T$ $6EԉD$E<$D$U$eE<$ZU|}v?xv$y<$UEM}uMtYEąxUċfB$PXvEv&UvA $P뜐t&UD$ED$ u}D$@D$E $N1t=ƋED$E$lj4$SE$H1$]u}]Ít&UWVSãd$ԍU܉D$ T$D$4$;EE܅t`1҉uv9uvOUD$ twUD$D$E$ tEuGv<$P9uwED$ED$E $d$,[^_]Í&u G<$PUtd$,[^_]ËB$P琍&UWVSÅd$čLD$D$D$ D$$$!EPE@87}'&EE0D$=4$t)4$D$<$Et$$wF4$PnG<$PEE0et&UBD$E܉T$$Au7U@D$ED$$|d$<[^_]Ðt&C3F4$PU|$t$$-vB$P_U܍@D$D$$-_@D$ED$$:U܍lAD$D$$fGD$ED$$U܍@D$D$$=D$ED$$tU܍@D$D$$O@D$ED$$*\U܍@D$D$$7@D$ED$$U܍@D$D$$@D$ED$$U܍@D$D$$q@D$ED$$L~U܍@D$D$$'YAD$ED$$4U܍AD$D$$AD$ED$$U܍AD$@D$$&AD$ED$$nU܍D$]$D$E܉$Fu F$E@Eҍ FtGU܍B$|$D$رBD$E܉t$$輱ǃ$EBJ8J@PH<$D$E4$FEBD$$趴M'Ud$ȉ]E7Eu}U$NjE $u9t tZtu F4$P]u}]Ðt&t҉D$E|$$ E|$t$$뛍t&G<$P뛍'UWVS~5d$ԍD$D$D$ FD$$t$Uud$,[^_]Í&tD$<$SD$螰xҍS$D$S$D$2~S$D$qdT$D$*J T$D$u0T$D$-T$D$3$T$D$=,T$D$4T$D$&;T$D$ AT$D$zHT$D$K`RT$D$DFWT$D$,]T$D$WdT$D$'nT$D$ivT$D$G}T$D$BT$D$wT$D$ vT$D$(\T$D$BT$D$(T$D$T$D$ZT$D$aT$D$5T$D$pT$D$`T$D$\rT$D$XT$D$ >T$D$M$U$D$I U$D$jU$D$7U$D$l%U$D$,,U$D$P4U$D$@n;U$D$4TAU$D$ :GU$D$H V$D$QU$D$1YU$D$[dU$D$kU$D$sU$D$r|U$D$djU$D$vPU$D$ 6U$D$0U$D$TU$D$U$D$LU$D$U$D$!U$D$6U$D$ofU$D$LU$D$]2U$D$U$D$cU$D$+V$D$F V$D$EV$D$yV$D$/|!V$D$Jb)V$D$H0V$D$R.8V$D$?V$D$CGV$D$fQV$D$n[V$D$bV$D$iV$D$zxpV$D$<^wV$D$9DV$D$8*V$D$OV$D$V$D$V$D$#V$D$kV$D$YV$D$QtV$D$%ZV$D$x@V$D$g&V$D$e V$D$tV$D$?V$D$ V$D$XW$D$VW$D$pW$D$"VW$D$S<&W$D$."-W$D$h8W$D$bCW$D$_NW$D$NVW$D$ ]W$D$$jW$D$lqW$D$URzW$D$^8W$D$>W$D$;W$D$#W$D$mW$D$W$D$W$D$sW$D$hW$D$AN_F4$PQUd$D$D$ ]}W}uD$D$$$tLG GtMXt$D$<$̢Wt$D$<$賢ǃG]u}]Ít&4$D$럍Ud$؉uƋE]I|}t$D ]u}]Ð D ]u}]ÍUWVS<{d$䍃 G$t{1҉$gF$UF$rGF $dGF$'F$F$ud$[^_]Í&t 1d$[^_]ËG<$1PvUWVS^{d$$tVt&t?tXD$<$8u4uыF4$Puȍ&d$[^_]Ëu F4$Pt1d$[^_]Í&G<$1Px܍&'US7zd$܍ED$WD$E $虴1u d$$[]fE$ t d$$[]ËED$XD$X$L1US÷yd$܍ED$ D$WD$E $1ud$$[]ËE$5t dd$$[]ËED$XD$X$IJ1빐U"*yEw]]UWVSNyd$9@ vd$1[^_]ÍvXᐍt&9vލH9v׍@9v΍@볍9v89ʉMr1 ItEt9wf@ 9r녍v9z8q롍d$[^_]Í&QE9/?t&UWVSZxd$ԋE9֍DEw9vv1d$,[^_]Ít&,Yt&9v݋xԍ9r͍F9vƍFN9vF9w=wF tU$at9vw&vg9qd9YF9NFN9@F95=*F Mt $9>tv99N9FFtU$uut&9> v9sf9[v>Elj~v91?(W9G 9WLEt ;M99BMU|$tl&9M9v~t&9qE9vcN9XVUC98}vuvux :4AM $99vM؍DE‰MUtv9|9qV9fNMN9UN 9JE=M.MEDvEt^9F9L9M49ut!;1t&;@9wEuZ;ut&9&v9sU9cfYU܉r;~v׍vf뿍v9>tčv벍E܋Uu|U؍tU4UuuwvwUԋEiv UMMtHd$<ɉ[^_]Ðt&또&UщWVƉSz_d$EEԉE؉f1eUE܋vv1ɍd$<[^_]Ðt&dZt&;>r;~v׍vf뿍v9>tčv벍UċU܅uU؍tU4Uuuqt&wUԋEav MMMt@d$<ɉ[^_]Í'USG^d$t8t+t`D$$d$[]Ðt&`sd$[]Ít&UWVS,]d$ԉE܋Ed d$,[^_]ÍE܋x D$}$|$T$视E}1tU܃EPFUFB BU܋B UB$VU؋FV+U؉E}UB(+U؉}UB,E܋H ~u1Lt&D(tHT,t@+U؉}UD0T,+U؉}UD4U܍I9J ~ G9F$}ED4D0ՍvUFBFBF B 1&UVSF\d$uFt ҉tOF t ҉t-Vu FP$R4$kd$[^]ÍvF P$RfFP$R룍v'Ud$]uî[uF =Ft҉u FP$R4$]u]Í'Ud$؉uƉ]}I[P1;L~CҍBI|<EljD$H$jtHL1]u}]ÍvHt$֖džHdžPdžL빉'UWVSÓZd$U@ E؋PA 9LHPG(4FUV EЉMEUF V85EE F HN v&d$l[^_]Í&Z␍t&@;G$}~T(UD,EtlthE9Ew`F9EvRuvBvB9u9Ev&Uȉ$XE$X9EUt֍P1IU܋VMP}2Hu΃ T[v[H t U+U9wPDF MaMP =0VN VP=t&FP#vV9U @qtF F@;G$T(D,E;UsKF9E: }ԋ}t&9E: R@9׉Fwߋ}ԋN IN @;G$T(D,9IN R&F+A;GPQ 9L HPU@ fFQ9UV B- F<tG$FG FB=t 9FPFʉ M9LHEPU܉@ PtG G$9~@9~vD(@9uW$FD(F !TF2FFNP;JHPQ 9L HPU@VƋR P MvTFFFNP;J{PQ 9L HPU@농&F9EAyF FF t&x V@[t&G$FW VT҉V{P 9L+ʉM[M} HuƋPV9U4;P(IFN DF9E $X‹F s@F fV9U;Pt&F9E$XEF $X9EyF+A;GgPQ 9LHPU@ V ƃP M;t&F9Ex^@FF9Ewv$FT FV PFTP F@FTFP‰E 9LC HEPU܉@V Ƌ P MM`FQ9U7F P @$puHVF‰UVV ;B< G$FG FU<W U;JFP‰E 9L%HEPU܉@ "vF9Et$XEF $X9EQIfF F S7VR TV$EĩEȅuULVJPP F~ЍP똅x1iuFV $uH3FFFG$FG V &A VFMЍPFnnG$FG F NE't&VTVVW$VW NMNQR9Ur nEPQ 9L5HPU@t&HVTVt&AF mfAF9E؉E N &uҋFN1PPt&}1PW$VW VP@ TQ 9LHPU@V P ƉMR9T;PUW$VҋG FP 9LHUЉL$MȉT$$輑MPPA9LHF@ PFPPQ 9LHPU@VUPEQ 9LHPU@ V ƉP McHUЉL$MȉT$$ՐMPN P@ TQ 9L/HPU@V P ƉM MM}Hu܋Pƃ >$R uHV ;B`FF M6M}GHu܋Pƃ $ MMV}3Hu܋Pƃ ; MM}Hu܋Pƃ MM}|Hu܋Pƃ 3OG 9S9E913E&N GO 9ȉM9Ev6BUȈEMMEUHu 1ɀ}_M1;Us0ˆUEΊỦEԋMԸQu 1}_9EYGO 9ȉMx9Ev6BUȈEMpMEUHu 1ɀ}_M1;Us0ˆUE7ỦEԋMԸQu 1}_3E1;W ;W q^PG EB9E;U0GO 99kB_^9PE^91;WOG 9(9E919EGO 99B^9:/^9s;W)BUȉ$CU,Uȉ$ U4v }}9Hu܋Pƃ F}\Hu֋PF9EA 7NMʉMM}WHu֋P@HP M=M}Hu܋Pƃ MM]}?Hu܋Pƃ %PH XP MM}Hu܋Pƃ ;AUt&3wP1f B}Hu܋Pƃ 1O11PH XPH PH MPPH PH C1HPDF9JgN}}؍9v ;FFINF9B~܋},HPPH Mԃ~t,F~(MЉT$EԉD$EЉ$zFG$FG N PH PH BUȉ$M|U-G E'BUȉ$$|UG E)PH }P‰E 9L)HEPU܉@$lUi$趓US$pU=:_h/^ b}Hu܋Pƃ F~6 ЍHL$MЉD$ $ÆFPFG$FG VFFFFG$FG NnNV XBUȉ$AU]BUȉ$臒UCBUȉ$=U)z_G EHPH BUȉ$ƧUBUȉ$ UBUȉ$¥Uz_{G E *}Hu܋Pƃ $,UL$vU6$0U :_S M@MHu܋Pƃ PH &UщWVd$ЉEPU@ Et:uEu1<Mf9u1d$0^_]ËquA uuv)ƉEB;UBEEEAEqu܍q}|AL;UsE܍ EM؍EԉЋU+EUE1t&U ; u9 uEEU9Uw%ZtEp0UEsvEyDALA}IEMM9U;ErtQ1ȋUMM뿐t&@9E;EUPEЋUMu^U؋EJUԋEEU9U*};}U:zEyظ1'Uщ‰WVS*>d$ԉE}z ƉEt)‰U܋U‰U؋U9UO}؃9w[⍶ t&U9vE| uu+Ed$,[^_]Ðt&9v't&x ^u v9w名t&uud$,)Ɖ[^_]Ðt&}v9vߍIMt&v9EuUu믍t&9NjIv9t 9uv9w눋I9ljMv}}v9u|$X;Et뛐9NjIH9u<9-v9w!I9ljM}} fv9uv$X;Eu4fuut&'UWVS<<d$U@ E؋PA 9LHPG(4FUV EЉMEUF V8-EEF HN v&d$L[^_]Í&$\␍t&@;G$}vT(D,Etgtc;Uw^F9EvJ։fBvB9u9Ev$Ủ$XE$X9EUt‰֋P1IU܋VMP}:Hu΃ &\vÎH t U+U9wPDF t& MMP =0VN VP5t&FPvV9U@tF F@;G$T(D,E;UsJF9E; }ԋ}9E; R@9׉Fw}ԋN IN &@;G$T(D, 9IN R&AF;GPQ 9L HPU@ t&FQ9UV B< F<kG$FG FB=t 9FtPFʉ M9LHEPU܉@ t&PtG G$9~@9~vD(@9uW$FD(F TFFFNP;JXPQ 9L! HPU@f&TF=FFNP;JPQ 9L? HPU@VƋR P M"vV9UAF FF x V@\t&G$FW VT҉VP 9L;ʉMM} HuƋP V9U$;PIFN =fF9E$X‹F  &@F fV9U;PtF9E$XEF $X9ErfAF;GZPQ 9LHPU@ V ƃP M6&F9Ew!^tF9E@F$tF* FV PFTP F@FTFP‰E 9L HEPU܉@V Ƌ P MMXFQ9U&F P @$guHFF‰UVV ;J< G$FG FU< U9JFP‰E 9Ly HEPU܉@ vF9E\$XEF $X9EA2fF F SVR TV$E$E̅uULVJPPV F~ЍP똅x1iuFV $,uH3FFFG$FG V & NFMЍPFnnG$FG F NE7t&VTVVW$VW NMNQR9Ur nEPQ 9L HPU@St&(V F 0VTVt&AF UfQV9U؉U[ N &uҋVN1PPt&}1PW$VW VP@ TQ 9LHPU@V P ƉMzR9T;PUW$VҋG FP 9LVHUЉL$MȉT$$tMPPA9LHF@ PFPPQ 9LkHPU@jNMPUQ 9LHPU@ V ƉP MKHUЉL$MȉT$$sMPN P@ TQ 9LHPU@V P ƉM MM}cHu܋Pƃ +$R uHV ;B@FF M{Mx}Hu܋Pƃ  M>M;}Hu܋Pƃ MM}Hu܋Pƃ MM}sHu܋Pƃ GO 9ȉM-9Ev6Ju ỦMmMEUHu 1_E1;Us*uUSmU̸Qu1_9ErN 8G EB9E;UGO 9t9&B^9^9xGO 99B^9^9 ;W_B^@1;WOG 99E911;W ;W ~OGO 9ȉM>9Ev6Ju ỦMkMEUHu 1_E1;Us*uUdkU̸Qu1_3EOG 99E9r1ӋỦ$bU봋Ủ$bUy }8Hu܋Pƃ ff}UHu֋PV9UA FEIʉM M}OHu֋Py MM}&Hu܋Pƃ HP MM~}7Hu܋Pƃ ^PH M0M-}JHu܋Pƃ ;Q&PYP1 }Hu܋Pƃ 11;1R1PH PH PH PH :UPPH 'HPDF9JF}}ؐt&9v ;NN@FN9J~݋}MHP/PH Mԃ~t,F~(MЉT$EԉD$EЉ$kFG$FG N PH ,BỦ$^U$G EBỦ$^U`G EPH PH }PʉM 9LHEPU܉@ ^^}THu܋Pƃ V@^2S$裋U!$uU $詉U:_1F~6 ЍHL$MЉD$ $RiFPFG$FG VFFF FG$FG NnNV `$ՊUr$ uU]$ۈUH:_?1PH BỦ$nUBỦ$tUBỦ$lUz_G EBỦ$ UBỦ$QtUnBỦ$UUz_KG ED M M Hu܋Pƃ }tHu܋Pƃ 2PH fUщWVd$ЉEPU@ Et:uEu1OMf9u1d$0^_]ËqEuq Ev)uEB;UBEEEAEqu܍q}|AL;Us+EUEԋE+EE؋E܉U܋UU 1Mt&U ; uf9 uEU9Uw'tEp0UEvEyDALA}IEMM9UE9rtQ1ȋUM2Mzv@9ECUEEԉBEE؉EuZUE9U܋EU9U};}U:zEظ1U卤$H]E贇k!D$ED$ED$0D$ G_D$ED$E u}EE$u1]u}]Ít&tE܋UD$ED$E$ttE$gU(pl9t趻lt\ \UB )ʋ)ʉD$D$E$x'p|$$Er҉&;,9pt1yt&$?yEP p1vDU9r YEv$tD$:u΋pt1蕺E$tD$p믋ltONWh<$RhF4$PgG<$PJp2vU卤$8]Et+D$ED$@D$ T_D$ED$E u}E$}u1]u}]ftEU$tD$D$гtE$5nE(phDžlEt 9ltqXhtX;)ȉp)ʉD$D$E$NuD$<$o҉xu1xlE;p Ev$tD$jt>D$<$dnd ɉ uJd$Qd딍t&t1蚷t&p9trrht_lp;fVd4$RdF4$Pip+D$D$E$sD$4$m҉tt誶$Wd<$Rdщt苼U卤$H]EûD$ED$ED$lD$ ^_D$ED$E }u}EE$.zu1]u}]ÍvE܍D$ED$E$]tǃEt4W(t覵Uut$뉍W(tʍ&Ud$ȉ]uþu}~ شF~(F t,V(E?U1t,]u}]fV(EU1uԋUF$SMtN V9t N뮐t&V V(V랍'Uщ‰WVSJd$ԉE܁}z ƉEt)U؋U9U؍UO}9w ]␍t& t&U܋9vE| uU܋+Ed$,[^_]f9vt&w ^uv9wuUd$,)‰[^_]f}v9vߍIM t&v9vE臸uvU܉u뱍9NjIv9t뜐9uv9w닍vI9ljMv}}v9uv$X;Et랍9NjQvE9u<90v9vw!I9ljM}}fv9uD$X;Eu/ U卤$H]Ed}D$ED$ED$|D$ j_D$ED$E }u}EE$vu1]u}]ÍvE܍D$ED$E$转tljE䃽t7W(gtRut$OzW(萻tǐ&Ud$ȉ]uW|u}~ (F~(F t,V(EQ1t,]u}]fV(EcQ1uԋUF$裷}tN V9t N뮐t&V V(V랍'UVS{Vd$uF t4$"dFt ҉tPFt ҉t.Ft҉u FP$R4$hmd$[^]ËFP$RfFP$R뢍v'UVSzöd$JAVuK@Ht.T$ $JtjPBTuA҉td$ [^]Í$Xd$ [^]ËV4$EREd$ [^]Ð4$X҉uӍv{m릍Ud$4$|$Ƌ}(‰}|$4$]钭fUWVSzd$ EED$@D$ u_D$ED$E $MsuEEЍd$L[^_]Í+xEtUB@tՍ:D$T$$uP@ 0Eu-vEU9WG Uԋ4tcE$Et5D$EЉỦt$$OvŰ ɉ uJẺ$QE됋u F4$Pt&u G<$PUЋB$PEt&G<$PvUWVS^xd$ԋ} EEW҉Uu |EEd$,[^_]tsE$kEtNM~G1U܉D v9u~. T $Eu؋U܋t6EE܍d$,[^_]Í& W EEd$,[^_]DU܋B$P뼍UVSow&d$Ћ|EED$ܐD$E uD$ D$$|91u d$0[^]Ít&Ux*;F$}%D,D$}$td$0[^]Í&/_D$$Vl1랍v'UVSvfd$Ћ|EED$̐D$E uD$ D$$81u d$0[^]Ít&UFx*;F$}%D(D$}$sd$0[^]Í&/_D$$k1랍v'Ud$$]uu×}ƉULit!4$gt*G E$ gtG]u}]Ít1܋G<$1PύUVS_ud$Ћ|EED$_D$E uD$ D$$l71u d$0[^]Ít&Ux";F$}T,D(d$0[^]Í/_D$$Nj1fUd$ȉ]E t^UD$u}T$$EEtu]u}]g_ u u!MA xWD$}$q뺐 _u u>UB@t!R xT$$Sugv kfa~u uUB tԃr B_u uMAqU p9u/M Q:qu pI:JuMAq__9u,U B:_uB:AuB:Au MA_u UBUB$$af`My$~M1EUD ;~$}3T,D(uuF4$1P փMq0M L$1$g'Ud$ȉ]u7r ҉}u1]u}]ÍpU$Ntډ$i3Utqtt$ $UM[MƋUt_tT$U4$WɉUtL ɉ kJE$QEWt&GM<$PMUxA $PU듋NE4$QUE렍&US0q d$EU D$T$ @$D$dNd$_[]'UWVSpÓ $DT$lxhDž\E$lTlD$D$ZX$kd.TE(1`1p9t}9 tE t U ;Ulɤ`lo Eg++p;pt;t\$hփ; t%dt$$6[҉oxKE9f`l0Ddlh1$[^_]Ðt&pXT$|$$`tdD$$\Z҉m\lT$ǩ=D$$EKD$hP$SPƋthtMmVP4$RPwVP4$RP1G<$P먐t&B$P덐t&9f~KD$X|$$`_NdD$$YNj#l(h!XD$D$$^1dzuUD$T$8?$ jUE$UU &@58\Ru틅Tt$D$$CI_hEh$g\ &B$PB$PU &@ҍv8\Ruhn4$D$cUm$^CdB T$P<$8QP ɉ ҉tu҉tSv_F4$fPhDž\B$P9B$P1VP4$RP떋WP<$RPqJP$QPL谥|G<$PnA]hu B$PlO1ou G<$PJF4$P1D$ ED$cD$E uE$Vu1]u]ÍE$t߉EUpT$t$@ $%3M҉uUJE$QE뜍t&UVSOÖd$ЍED$ED$ ED$cD$E E$1t0EuD$ED$D$ t$$Ld$0[^]Ít&'Ud$]EGOD$ cD$E u}Eu$t$u1]u}]ËExD$$:t׉EPHT$@ $UԉD$T?Uԉ4$T$DxE똍'USNGd$̍ED$ED$ ED$cD$E EE$M1tEtUD$ET$$HMd$4[]Ð;*E؍&'USN÷d$̍ED$ED$ ED$cD$E EE$1tEtUD$ET$$Hd$4[]Ð)E؍&'USpM'd$܍ED$ dD$E $I1t E$d$$[]Í&US Md$E $:@1u d$[]ÐUd$EP1t E$D$U Í&'UWVSLed$4$%ƃ@/ƃT/ƃh/D$D$D$ ]D$$=pD$D$Wd$8GtbD$<$adD$ xEft$D$<$ x(CJGtD$<$pdD$p d$L[^_]Í&KPEJEIEHEGEFEEEDECEBEAE݋T@XD\H`MLLdPdE爋a_`E拻^ƃT/E刃]E䈃\E㈃[E∃ZEሃYEXE߈WEވVE݈UEEEEEEEEE~E}E|E狃|E׈E݈EވE߈EEሃE∃E㈃E䈃E刃E戃E爃UWVSHÓd$ԉU$&NjE$&D =w_Et$$*uED$4$*ufvt<.u/vuE$j&d$,[^_]ÍeD$G$=ؐ&UWVSH$$D$.eE1PF D׉$<$1xc@ts@ fR:tXT$$)F|$$4tNjBUe3u$<[^_]Ð US Gd$܍ED$dD$E $9u 1d$$[]Ít&UEtt$΋ED$dD$G$1뫍Ud$؉]EF>D$ ED$dD$E uEu$u1]u]ÐUttfً ΍vUWVƍES Fd$D$$$ẺD$ EЉD$EԉD$E؉D$E܉D$ED$ ED$dD$u1d$l[^_]ÍJ4$D$.ED$D$<$<$=PKED$<$D$<$Ɖ<$UMԅU܍L1ȉEԉT$$J$EċED$D$<$hE܉|$ D$ED$$bno mem for bitsetMSTARTRULERHS ALTITEMATOM8 Calculate FIRST set for '%s' Left-recursion for '%s' Left-recursion below '%s' FIRST set for '%s': { } Adding FIRST sets ... Re-calculating FIRST set for '%s' ??? no mem for new sym in calcfirstsetno mem to resize sym in calcfirstsetTranslating label %s ... Label %s is non-terminal %d. Label %s is terminal %d. Label %s is a keyword Can't alloc dest '%s' Unknown OP label %s Can't translate label '%s' Label %d/'%s' not found grammar.c:findlabel()Label @ %8p, %d: %s no mem for new grammarCan't translate NAME label '%s' Can't translate STRING label %s no mem to resize arc list in addarcno mem to resize state in addstateno mem to resize labellist in addlabelno mem to resize dfa in adddfaout of memSubset DFA %s Subset %d (finish) { %d Arc to state %d, label %s no mem for new nfa grammarno mem for new nfaDump of NFA for '%s' ... %c%2d%c-> %2d %s Making DFA for '%s' ... before minimizingRename state %d to %d. after minimizingCompiling (meta-) parse tree into NFA grammar NFA '%s' has %d states; start %d, finish %d no mem for xx_state in makedfaError: nonterminal '%s' may produce empty. input line too longcan't re-enter readlineآ 0@`ȢL\\\\\\\\\\\\\\\\\L\\\\\\\\\\\\L\\\\\\\\\\\\\\\\\L3 3333333333 3233333333333333333333333333 3 !333333333333333333333333333 utf-8utf-8-iso-8859-1iso-latin-1iso-8859-1-iso-latin-1-with BOMencoding problem: %sunknown encoding: %srbtok_backup: begin of bufferTab size set to %d ENDMARKERNAMENUMBERSTRINGNEWLINEINDENTDEDENTLPARRPARLSQBRSQBCOLONCOMMASEMIPLUSMINUSVBARAMPERLESSGREATERPERCENTBACKQUOTELBRACERBRACEEQEQUALNOTEQUALLESSEQUALGREATEREQUALTILDECIRCUMFLEXLEFTSHIFTRIGHTSHIFTPLUSEQUALMINEQUALPERCENTEQUALAMPEREQUALVBAREQUALCIRCUMFLEXEQUALLEFTSHIFTEQUALRIGHTSHIFTEQUALDOUBLESTAREQUALDOUBLESLASHDOUBLESLASHEQUALtab-width::tabstop=:ts=set tabsize=%s: inconsistent use of tabs and spaces in indentation Non-ASCII character '\x%.2x' in file %.200s on line %i, but no encoding declared; see http://www.python.org/peps/pep-0263.html for details<> not supported in 3.x; use !='%100s' does not have the buffer interfacenull argument to internal routineobject of type '%.200s' has no len()'%.200s' object doesn't support slice deletion'%.200s' object doesn't support item deletion'%.200s' object does not support item assignment'%.200s' object does not support indexing__index__ returned non-(int,long) (type %.200s)'%.200s' object cannot be interpreted as an indexbad operand type for abs(): '%.200s'bad operand type for unary ~: '%.200s'bad operand type for unary +: '%.200s'bad operand type for unary -: '%.200s'expected a writeable buffer objectexpected a single-segment buffer objectexpected a readable buffer objectexpected a character buffer objectissubclass() arg 1 must be a classissubclass() arg 2 must be a class or tuple of classesisinstance() arg 2 must be a class, type, or tuple of classes and types while calling a Python objectNULL result without error in PyObject_Call'%.200s' object is not callableattribute of type '%.200s' is not callable'%.200s' object is not iterableiter() returned non-iterator of type '%.100s'argument of type '%.200s' is not iterablesequence.index(x): x not in sequence'%.200s' object doesn't support slice assignment'%.200s' object is unsliceable'%.200s' object can't be repeated'%.200s' object can't be concatenatedunsupported operand type(s) for %.100s: '%.100s' and '%.100s'PyNumber_ToBase: index not int or long__float__ returned non-float (type %.200s)null byte in argument for long()__long__ returned non-long (type %.200s)__trunc__ returned non-Integral (type %.200s)long() argument must be a string or a number, not '%.200s'null byte in argument for int()__int__ returned non-int (type %.200s)int() argument must be a string or a number, not '%.200s'cannot fit '%.200s' into an index-sized integercan't multiply sequence by non-int of type '%.200s'sequence index must be integer, not '%.200s''%.200s' object does not support item deletion'%.200s' object is unsubscriptableunsupported operand type(s) for ** or pow(): '%.100s' and '%.100s'unsupported operand type(s) for pow(): '%.100s', '%.100s', '%.100s'format expects arg 2 to be string or unicode, not %.100sType %.100s doesn't define __format__%.100s.__format__ must return string or unicode, not %.100sboth destination and source must have the buffer interfacedestination is too small to receive data from sourceObject is not writable.__class__ in __subclasscheck__ in __instancecheck____int____getitem__count exceeds C integer sizeindex exceeds C integer size%=//=-=>>=<<=&=^=|=+=%//>><<^|+__trunc__**=** or pow()__length_hint__|O:boolTrueFalsesingle-segment buffer object expectedPy_TPFLAGS_HAVE_GETCHARBUFFER neededaccessing non-existent buffer segmentwritable buffers are not hashablebuffer assignment index out of rangeright operand must be a single byteright operand length must match slice lengthbuffer indices must be integerssequence index must be integer<%s buffer ptr %p, size %zd at %p><%s buffer for %p, size %zd, offset %zd at %p>offset must be zero or positive%s buffer type not availablebuffer is read-onlybuffer index out of rangeresult too largeread-writesize must be zero or positivebuffer object expectedbuffer() not supported in 3.xbuffer()O|nn:buffer  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~B.isspace() -> bool Return True if all characters in B are whitespace and there is at least one character in B, False otherwise.B.isalpha() -> bool Return True if all characters in B are alphabetic and there is at least one character in B, False otherwise.B.isalnum() -> bool Return True if all characters in B are alphanumeric and there is at least one character in B, False otherwise.B.isdigit() -> bool Return True if all characters in B are digits and there is at least one character in B, False otherwise.B.islower() -> bool Return True if all cased characters in B are lowercase and there is at least one cased character in B, False otherwise.B.isupper() -> bool Return True if all cased characters in B are uppercase and there is at least one cased character in B, False otherwise.B.istitle() -> bool Return True if B is a titlecased string and there is at least one character in B, i.e. uppercase characters may only follow uncased characters and lowercase characters only cased ones. Return False otherwise.B.lower() -> copy of B Return a copy of B with all ASCII characters converted to lowercase.B.upper() -> copy of B Return a copy of B with all ASCII characters converted to uppercase.B.title() -> copy of B Return a titlecased version of B, i.e. ASCII words start with uppercase characters, all remaining cased characters have lowercase.B.capitalize() -> copy of B Return a copy of B with only its first character capitalized (ASCII).B.swapcase() -> copy of B Return a copy of B with uppercase ASCII characters converted to lowercase ASCII and vice versa.Existing exports of data: object cannot be re-sizedaccessing non-existent bytes segmentType %.100s doesn't support the buffer APIO|O&O&:find/rfind/index/rindexan integer or string of size 1 is requiredComparison between bytearray and stringbytearray object is too large to make reprdeallocated bytearray object has exported bufferscannot add more objects to bytearrayencoding or errors without sequence argumentunicode argument without an encodingencoding or errors without a string argumentNegative size passed to PyByteArray_FromStringAndSizetranslation table must be 256 characters longcan only join an iterable of bytes (item %ld has type '%.100s')non-hexadecimal number found in fromhex() arg at position %zdbytearray indices must be integerscan't set bytearray slice from %.100sbytearray indices must be integerattempt to assign bytes of size %zd to extended slice of size %zdO|O&O&:countO|O&O&:startswithO|O&O&:endswithsubsection not foundstring must be of size 1byte must be in range(0, 256)bytearray index out of range(O(Ns)N)Objects/bytearrayobject.cGC object already trackedbytearray(bvalue not found in bytearray|n:popcannot pop an empty bytearraypop index out of rangenO:insertcan't concat %.100s to %.100s|Oss:bytearraynegative countn:zfilltranslate|O:strip |i:splitlines|On:splitempty separator|O:rstrip|On:rsplitn|c:rjust|O:lstripn|c:ljustcan only join an iterableU:fromhex|i:expandtabsresult is too longn|c:centerOO|n:replacereplace string is too longreplace bytes is too longbytearray_iterator0123456789abcdef__alloc____sizeof__appendcapitalizeextendisalnumisalphaisdigitislowerisspaceistitleisupperjoinreverserfindrpartitionswapcase``````?Cell is emptyObjects/cellobject.ccellcell_contentscell comparisons not supported in 3.x__doc____coerce__ after coercion__rtruediv____truediv____rfloordiv____floordiv____ror____or____rxor____xor____rand____and____rrshift____rshift____rlshift____lshift____rdivmod____divmod____rmod____mod____rdiv____div____rmul____mul____rsub____sub____radd____add____itruediv____ifloordiv____ior____ixor____iand____irshift____ilshift____imod____idiv____imul____isub____iadd____rpow____pow____ipow____cmp____lt____le____eq____ne____gt____ge__ in __call____delitem____setitem____contains____delslice__(N)(nn)__setslice__(NO)(nnO)(nO)__getslice____len____len__() should return >= 0__index____hex____oct____float____long____invert____abs____pos____neg____nonzero__instance has no next() method__iter__iteration over non-sequence__hash__unhashable instance__repr__<%s.%s instance at %p>__str____del____getattr____setattr____delattr__Objects/classobject.cinstancemethodO!|O:instance__init__() should return NoneSOOclassobjbasesim_classim_func__func__im_self__self__coercion should return None or 2-tuplecomparison did not return an int%.200s instance has no __call__ methodinstance.__dict__ not accessible in restricted mode%.50s instance has no attribute '%.400s'in 3.x, __delslice__ has been removed; use __delitem__in 3.x, __setslice__ has been removed; use __setitem__in 3.x, __getslice__ has been removed; use __getitem____len__() should return an intobject cannot be interpreted as an index__nonzero__ should return an int__nonzero__ should return >= 0__iter__ returned non-iterator of type '%.100s'class.__dict__ not accessible in restricted modeclass %.50s has no attribute '%.400s'__dict__ not accessible in restricted mode__dict__ must be set to a dictionary__class__ not accessible in restricted mode__class__ must be set to a class__hash__() should return an intclasses are read-only in restricted mode__dict__ must be a dictionary object__bases__ must be a tuple objecta __bases__ item causes an inheritance cycle__name__ must be a string object__name__ must not contain null bytes__bases__ items must be classesfirst argument must be callableunbound methods must have non-NULL im_classinstance() second arg must be dictionary or Nonethis constructor takes no argumentsPyClass_New: name must be a stringPyClass_New: dict must be a dictionaryPyClass_New: bases must be a tuplePyClass_New: base must be a classunbound method %s%s must be called with %s instance as first argument (got %s%s instead)the class associated with a methodthe function (or other callable) implementing a methodthe instance to which a method is bound; None for unbound methodsInvalid call to PyCObject_SetVoidPtrPyCObject_GetDesc with non-C-objectPyCObject_GetDesc called with null pointerPyCObject_AsVoidPtr with non-C-objectPyCObject_AsVoidPtr called with null pointerPyCObject_FromVoidPtrAndDesc called with null descriptionPyCObjectname tuples must contain only strings, not '%.500s'code inequality comparisons not supported in 3.xcode: argcount must not be negativecode: nlocals must not be negative0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ_abcdefghijklmnopqrstuvwxyz???non-string found in code slotObjects/codeobject.ciiiiSO!O!O!SSiS|O!O!:codeco_argcountco_nlocalsco_stacksizeco_flagsco_codeco_constsco_namesco_varnamesco_freevarsco_cellvarsco_filenameco_nameco_firstlinenoco_lnotab(dd)can't convert complex to longcan't convert complex to intcomplex() arg is not a stringfloat() out of range: %.150s|OO:complex__complex__complex divmod()complex remainderclassic complex divisionabsolute value too largecomplex modulocomplex exponentiation%%.%ig%%+.%ig(%s%sj)realimagconjugate__getnewargs__can't convert complex to floatcomplex() literal too large to convertcomplex() arg is an empty stringcomplex() arg contains a null bytecomplex() arg is a malformed stringcomplex() can't take second arg if first is a stringcomplex() second arg can't be a stringcomplex() argument must be a string or a numberfloat(r) didn't return a floatno ordering relation is defined for complex numbers__complex__ should return a complex objectcomplex divmod(), // and % are deprecated0.0 to a negative or complex powerthe real part of a complex numberthe imaginary part of a complex number?copyiteritemsitervaluesiterkeys(OO)|OOOO:propertycan't set attributecan't delete attribute(O)unreadable attributeOOOOmember_descriptorgetset_descriptorwrapper_descriptordictproxyfgetfdelmethod-wrapperclassmethod_descriptor__objclass__has_keyD.keys() -> list of D's keysgettersetterdeleterdescriptor '%s' for '%s' objects doesn't apply to '%s' objectdescriptor '%.200s' for '%.100s' objects doesn't apply to '%.100s' objectattribute '%.300s' of '%.100s' objects is not writableattribute '%.300s' of '%.100s' objects is not readabledescriptor '%.300s' of '%.100s' object needs an argumentdescriptor '%.200s' requires a '%.100s' object but received a '%.100s'wrapper %s doesn't take keyword argumentsdescriptor '%s' for type '%s' needs either an object or a typedescriptor '%s' for type '%s' needs a type, not a '%s' as arg 2descriptor '%s' for type '%s' doesn't apply to type '%s'D.has_key(k) -> True if D has a key k, else FalseD.get(k[,d]) -> D[k] if D.has_key(k), else d. d defaults to None.D.values() -> list of D's valuesD.items() -> list of D's (key, value) pairs, as 2-tuplesD.iterkeys() -> an iterator over the keys of DD.itervalues() -> an iterator over the values of DD.iteritems() -> an iterator over the (key, value) items of DD.copy() -> a shallow copy of Dreversed()reversed__reversed__O|O:enumerateargument to reversed() must be a sequencemessage__dict__ may not be deleted__dict__ must be a dictionarymessage attribute was deletedargs may not be deletedstate is not a dictionaryO!O!nnO!u%04xU%08x%s (%s, line %ld)%s (%s)%s (line %ld)[Errno %s] %s: %s[Errno %s] %stuple index out of rangeexceptionsNotImplementedErrorUnicodeTranslateErrorPendingDeprecationWarningss#nnssu#nns%.200s attribute not set%.200s attribute must be strexceptions.BaseExceptionexceptions.Exceptionexceptions.StandardErrorexceptions.TypeErrorInappropriate argument type.exceptions.StopIterationexceptions.GeneratorExitexceptions.SystemExitexceptions.KeyboardInterruptProgram interrupted by user.exceptions.ImportErrorexceptions.EnvironmentErrorexceptions.IOErrorI/O operation failed.exceptions.OSErrorOS system call failed.exceptions.EOFErrorRead beyond end of file.exceptions.RuntimeErrorUnspecified run-time error.exceptions.NameErrorName not found globally.exceptions.UnboundLocalErrorexceptions.AttributeErrorAttribute not found.exceptions.SyntaxErrorInvalid syntax.exceptions.IndentationErrorImproper indentation.exceptions.TabErrorexceptions.LookupErrorBase class for lookup errors.exceptions.IndexErrorSequence index out of range.exceptions.KeyErrorMapping key not found.exceptions.ValueErrorexceptions.UnicodeErrorUnicode related error.exceptions.UnicodeEncodeErrorUnicode encoding error.exceptions.UnicodeDecodeErrorUnicode decoding error.Unicode translation error.exceptions.AssertionErrorAssertion failed.exceptions.ArithmeticErrorexceptions.FloatingPointErrorexceptions.OverflowErrorexceptions.ZeroDivisionErrorexceptions.SystemErrorexceptions.ReferenceErrorexceptions.MemoryErrorOut of memory.exceptions.BufferErrorBuffer error.exceptions.Warningexceptions.UserWarningexceptions.DeprecationWarningexceptions.SyntaxWarningexceptions.RuntimeWarningexceptions.FutureWarningexceptions.ImportWarningexceptions.UnicodeWarningexceptions.BytesWarning__setstate____unicode__exception codeexception errnoexception strerrorexception filenameexception msgexception linenoexception offsetexception textexception print_file_and_lineexception encodingexception objectexception startexception endexception reasonBaseException.message has been deprecated as of Python 2.6__getslice__ not supported for exception classes in 3.x; use args attribute__getitem__ not supported for exception classes in 3.x; use args attributecan't translate character u'\%s' in position %zd: %.400scan't translate characters in position %zd-%zd: %.400s'%.400s' codec can't decode byte 0x%s in position %zd: %.400s'%.400s' codec can't decode bytes in position %zd-%zd: %.400s'%.400s' codec can't encode character u'\%s' in position %zd: %.400s'%.400s' codec can't encode characters in position %zd-%zd: %.400sexceptions bootstrapping error.Module dictionary insertion problem.Cannot pre-allocate MemoryError instance Cannot pre-allocate RuntimeError instance for recursion errorsmaximum recursion depth exceededcannot allocate argument for RuntimeError pre-allocationcannot allocate tuple for RuntimeError pre-allocationinit of pre-allocated RuntimeError failed%.200s attribute must be unicodeCommon base class for all exceptionsCommon base class for all non-exit exceptions.Base class for all standard Python exceptions that do not represent interpreter exiting.Signal the end from iterator.next().Request that a generator exit.Request to exit from the interpreter.Import can't find module, or can't find name in module.Base class for I/O related errors.exceptions.NotImplementedErrorMethod or function hasn't been implemented yet.Local name referenced but not bound to a value.Improper mixture of spaces and tabs.Inappropriate argument value (of correct type).exceptions.UnicodeTranslateErrorBase class for arithmetic errors.Floating point operation failed.Result too large to be represented.Second argument to a division or modulo operation was zero.Internal error in the Python interpreter. Please report this to the Python maintainer, along with the traceback, the Python version, and the hardware/OS platform and version.Weak ref proxy used after referent went away.Base class for warning categories.Base class for warnings generated by user code.Base class for warnings about deprecated features.exceptions.PendingDeprecationWarningBase class for warnings about features which will be deprecated in the future.Base class for warnings about dubious syntax.Base class for warnings about dubious runtime behavior.Base class for warnings about constructs that will change semantically in the future.Base class for warnings about probable mistakes in module importsBase class for warnings about Unicode related problems, mostly related to conversion problems.Base class for warnings about bytes and buffer related problems, mostly related to conversion from str or comparing to str.generator already executingthrowgeneratorsendgi_framegi_runninggi_codecan't send non-None value to a just-started generatorgenerator ignored GeneratorExitthrow() third argument must be a traceback objectinstance exception may not have a separate valueexceptions must be classes, or instances, not %sI/O operation on closed file (ss) (sss)Unknown newlines value 0x%x writingFile not open for %s|i:readlines*t#O|i:seek(isO)empty mode string|l:readlinesw*|l:readfilenowriteobject with NULL filestrictsoftspaceObjects/fileobject.c(i)EOF when reading a lineet|si:fileO|si:filebufferingtellreadintoxreadlineswritelinesflush__enter____exit__file namefile encodingUnicode error handlerTrue if the file is closednewlinesf.xreadlines() not supported in 3.x, try 'for line in f' insteadfile.softspace not supported in 3.xcan't delete softspace attributeclose() called during concurrent operation on the same file object.PyFileObject locking error in destructor (refcnt <= 0 at close).writelines() requires an iterable argumentwritelines() argument must be a sequence of stringsline is longer than a Python string can holdMixing iteration and read methods would lose datainteger argument expected, got floatuniversal newline mode can only be used with modes starting with 'r'mode string must begin with one of 'r', 'w', 'a' or 'U', not '%.200s'file() constructor not accessible in restricted modeinvalid mode ('%.50s') or filename<%s file u'%s', mode '%s' at %p><%s file '%s', mode '%s' at %p>close failed in file object destructor: requested number of bytes is more than a Python string can holdfileno() returned a non-integerargument must be an int, or have a fileno() method.file descriptor cannot be a negative integer (%i)null file for PyFile_WriteStringobject.readline() returned non-stringfile mode ('r', 'U', 'w', 'a', possibly with 'b' or '+' added)end-of-line convention used in this fileflag indicating that a space needs to be printed; used by print0HXO:__format__ss:__setformat__doubleunknownIEEE, little-endianIEEE, big-endian(d)frexp() result out of rangefloat divmod()C??CKKa float is requiredfloat moduloclassic float divisionempty string for float()infinfinitynan|O:float# cleanup floats: %d unfreed float%s -0x0.0p+0-0x%sp%c%dsys.floatinfoas_integer_ratiois_integer__getformat__max_expmax_10_expminmin_expmin_10_expDBL_DIG -- digitsmant_digepsilonradixFLT_ROUNDS -- addition rounds__format__ requires str or unicode__setformat__() argument 1 must be 'double' or 'float'__setformat__() argument 2 must be 'unknown', 'IEEE, little-endian' or 'IEEE, big-endian'can only set %s format to 'unknown' or the detected platform value__getformat__() argument must be string, not %.500s__getformat__() argument 1 must be 'double' or 'float'insane float_format or double_formatfloat too large to pack with d formathexadecimal value too large to represent as a floatinvalid hexadecimal floating-point stringhexadecimal string too long to convertCannot pass infinity to float.as_integer_ratio.Cannot pass NaN to float.as_integer_ratio.can't unpack IEEE 754 special value on non-IEEE platformfloat too large to pack with f formatnb_float should return float objectpow() 3rd argument not allowed unless all arguments are integers0.0 cannot be raised to a negative powernegative number cannot be raised to a fractional powerUnicode float() literal too long to convertfloat() argument must be a string or a numberinvalid literal for float(): %.200snull byte in argument for float()# Returns self, the complex conjugate of any float.Returns the Integral closest to x between 0 and x.Returns True if the float is an integer.DBL_MAX -- maximum representable finite floatDBL_MAX_EXP -- maximum int e such that radix**(e-1) is representableDBL_MAX_10_EXP -- maximum int e such that 10**e is representableDBL_MIN -- Minimum positive normalizer floatDBL_MIN_EXP -- minimum int e such that radix**(e-1) is a normalized floatDBL_MIN_10_EXP -- minimum int e such that 10**e is a normalizedDBL_MANT_DIG -- mantissa digitsDBL_EPSILON -- Difference between 1 and the next representable floatFLT_RADIX -- radix of exponent//h/P/@//  ?CA??MKA@314K%XXX block stack underflowXXX block stack overflow__builtins__lineno must be an integerf_backf_codef_builtinsf_globalsf_lastif_exc_typef_exc_valuef_exc_tracebackf_localsf_linenof_tracef_restrictedf_lineno can only be set by a trace functionline %d comes before the current code blockline %d comes after the current code blockcan't jump to 'except' line as there's no exceptioncan't jump into or out of a 'finally' blockcan't jump into the middle of a blockuninitialized staticmethod objectfunction attributes not accessible in restricted mode__name__ must be set to a string objectfunction's dictionary may not be deletedsetting function's dictionary to a non-dict__defaults__ must be set to a tuple object__code__ must be set to a code object%s() requires a code object with %zd free vars, not %zduninitialized classmethod objectexpected tuple for closure, got '%.100s'arg 3 (name) must be None or stringarg 4 (defaults) must be None or tuplearg 5 (closure) must be None or tuple%s requires closure of length %zd, not %zdarg 5 (closure) expected cell, found %sstaticmethodclassmethod'%s' object is not callableObjects/funcobject.cnon-tuple default argsO!O!|OOO:functionarg 5 (closure) must be tupleargdefsfunc_closure__closure__func_docfunc_globals__globals__func_code__code__func_defaults__defaults__func_dictfunc_name(l)(ll)an integer is required%ld# cleanup ints: %d unfreed int%s negative shift countclassic int division|Oi:intbasenumeratordenominatorinteger division or modulo by zeronb_int should return int object# pow() 2nd argument cannot be negative when 3rd argument specifiedpow() 3rd argument cannot be 0int() base must be >= 2 and <= 36invalid literal for int() with base %d: %sint() can't convert non-string with explicit baseReturns self, the complex conjugate of any int.Truncating an Integral returns itself.the numerator of a rational number in lowest termsthe denominator of a rational number in lowest termsBObjects/iterobject.ccallable-iteratorexpected a sortwrapperobject|OOi:sortlist modified during sortO|O&O&:indexlist.index(x): x not in listargument must be iterable|O:listObjects/listobject.clist index out of range[...], can only assign an iterablelist.remove(x): x not in listpop from empty list[]listiteratorlistreverseiteratorcmpwrappersortwrapperʱԱcomparison function must return int, not %.200sthe cmp argument is not supported in 3.xcannot add more objects to listlist assignment index out of rangemust assign iterable to extended sliceattempt to assign sequence of size %zd to extended slice of size %zdlist indices must be integers, not %.200scan only concatenate list (not "%.200s") to list while getting the repr of a listlong too big to convertObjects/longobject.cinteger conversion failedlong int too large to convertlong is too large to format|Oi:longclassic long divisioncan't convert negative long to unsignedlong has too many bits to express in a platform size_tlong int too large to convert to floatlong int too large to convert to intcan't convert negative value to unsigned longlong() arg 2 must be >= 2 and <= 36long string too large to convertinvalid literal for long() with base %d: %slong division or modulo by zerolong/long too large for a floatlong() can't convert non-string with explicit basecannot convert float infinity to integercannot convert float NaN to integerReturns self, the complex conjugate of any long.Returns size in memory, in bytesGP ^$@pop(): dictionary is empty__missing__{...}{}Objects/dictobject.csetdefaultfromkeysdictionary-keyiteratordictionary-valueiteratordictionary-itemiteratorpopitempopitem(): dictionary is emptydictionary changed size during iterationdict.has_key() not supported in 3.x; use the in operatordict inequality comparisons not supported in 3.xcannot convert dictionary update sequence element #%zd to a sequencedictionary update sequence element #%zd has length %zd; 2 is requiredmethod.__self__ not accessible in restricted modebuiltin_function_or_method order comparisons not supported in 3.x%.200s() takes no arguments (%zd given)%.200s() takes exactly one argument (%zd given)%.200s() takes no keyword argumentsObjects/methodobject.c__methods__builtin_function_or_method8ؕS|O:module.__init__# clear[1] %s # clear[2] %s __file__module filename missingnameless moduleObjects/moduleobject.cNotImplementeddeallocating NonePy_ReprCan't initialize type typeCan't initialize weakref typeCan't initialize bool typeCan't initialize str typeCan't initialize list typeCan't initialize None typeCan't initialize super typeCan't initialize object typeCan't initialize xrange typeCan't initialize dict typeCan't initialize set typeCan't initialize unicode typeCan't initialize slice typeCan't initialize complex typeCan't initialize float typeCan't initialize buffer typeCan't initialize long typeCan't initialize int typeCan't initialize tuple typeCan't initialize code typeCan't initialize frame typeCan't initialize method typeCan't initialize class typeCan't initialize wrapper typenumber coercion failedunhashable type: '%.200s'assign to__members__frame does not exist__dir__ in cmpObjects/object.c<%s object at %p>print recursionNULL object : NULLNoneTypeNotImplementedTypeCan't initialize callable weakref proxy typeCan't initialize weakref proxy typeCan't initialize bytearray typeCan't initialize NotImplemented typeCan't initialize traceback typeCan't initialize static method typeCan't initialize frozenset typeCan't initialize property typeCan't initialize enumerate typeCan't initialize reversed typeCan't initialize builtin function typeCan't initialize function typeCan't initialize dict proxy typeCan't initialize generator typeCan't initialize get-set descriptor typeCan't initialize instance typeCan't initialize ellipsis typeCan't initialize member descriptor typeattribute name must be string, not '%.200s''%.100s' object has no attribute '%.200s''%.50s' object attribute '%.400s' is read-only'%.50s' object has no attribute '%.400s''%.100s' object has no attributes (%s .%.100s)'%.100s' object has only read-only attributes (%s .%.100s)__members__ and __methods__ not supported in 3.xdir(): expected keys() of locals to be a list, not '%.200s'%.200s.__dict__ is not a dictionary__dir__() must return a list, not %.200stp_compare didn't return -1 or -2 for exceptiontp_compare didn't return -1, 0 or 1comparing unequal types not supported in 3.x__repr__ returned non-string (type %.200s) while getting the str of an object__str__ returned non-string (type %.200s) type : %s refcount: %ld address : %p ^xkAeHO(O(iii))Objects/rangeobject.cxrange()xrange(%ld)xrange(%ld, %ld)xrange(%ld, %ld, %ld)xrangerangeiteratorxrange object index out of rangel;xrange() requires 1-3 int argumentsll|l;xrange() requires 1-3 int argumentsxrange() arg 3 must not be zeroxrange() result has too many itemspop from an empty set%s(...)%s(%s)%s([])Objects/setobject.ccan only compare to a setfrozenset()frozensetsetiteratoradddiscardintersectionintersection_updateisdisjointissubsetissupersetsymmetric_differencesymmetric_difference_updateunionSet changed size during iterationcannot compare sets using cmp()XO(OOO)unhashable typeEllipsisslice(slice step cannot be zero(nnn)slice()ellipsisindicesstopstep(s#)unmatched '{' in formatMissing ']' in format stringempty field nameO|OO:find/rfind/index/rindexsubstring not foundrepeated string is too long\%c\t\n\r\x%02xstring is too largenew string is too longstring index out of range|O:strObjects/stringobject.cMax string recursion exceededTrailing \ in stringinvalid \x escapeignore%lu%zu%u%iformat requires a mappingincomplete format key* wants intwidth too bigprec too bigincomplete format%s0%c%%.%dl%c%s%%%s.%dl%c%%%s.%d%cc;%c requires int or charb;%c requires int or charbasestringformatteriteratorfieldnameiterator_formatter_field_name_split_formatter_parserSingle '}' encountered in format stringSingle '{' encountered in format stringend of format while looking for conversion specifierexpected ':' after format specifierzero length field name in formataccessing non-existent string segmentCannot use string as modifiable bufferThe basestring type cannot be instantiatedToo many decimal digits in format stringOnly '.' or '[' may follow ']' in format field specifierEmpty attribute in format string__format__ arg must be str or unicode, not %s'in ' requires string as left operand, not %.200scannot concatenate 'str' and '%.200s' objectsstrings are too large to concatdeletion of interned string failedImmortal interned string died.Inconsistent interned string state.releasing %zd interned strings total size of all interned strings: %zd/%zd mortal/immortal PyString_InternInPlace: strings only please!Negative size passed to PyString_FromStringAndSize%s arg must be None, str or unicodenot enough arguments for format stringstring is too long for a Python stringsequence item %zd: expected string, %.80s foundjoin() result is too long for a Python stringUnknown conversion specifier %cUnknown conversion specifier \x%xstring is too large to make reprexpected string or Unicode object, %.200s foundexpected string without null bytesdeletions are implemented differently for unicodestring indices must be integers, not %.200sdecoding error; unknown error handling code: %.400sencoder did not return a string/unicode object (type=%.400s)encoder did not return a string object (type=%.400s)decoder did not return a string/unicode object (type=%.400s)decoder did not return a string object (type=%.400s)%s argument has non-string str()int argument required, not %.200sformatted integer is too long (precision too large?)%%%c format: a number is required, not %.200sfloat argument required, not %.200sformatted float is too long (precision too large?)unsupported format character '%c' (0x%x) at index %zdnot all arguments converted during string formatting[BC_BBBXBțțIvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvv11111111vvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvՠvvvvĠvvvvvvvvvvvvvvv v`λλXλλλλλλλPλHλλ@Y666666666666666666666666666666666666666666666666666666666>66666666666d~QJ(O(OO))O|O:structsequnnamed fieldstructseq index must be integerconstructor requires a sequence%.500s() takes a dict as second arg, if any%.500s() takes an at least %zd-sequence (%zd-sequence given)%.500s() takes an at most %zd-sequence (%zd-sequence given)%.500s() takes a %zd-sequence (%zd-sequence given)tuple.index(x): x not in listObjects/tupleobject.c,|O:tuple,)tupleiteratortuple assignment index out of rangetuple indices must be integers, not %.200scan only concatenate tuple (not "%.200s") to tuple while getting the repr of a tupleThis object has no __weakref__PyArg_UnpackTuple() argument list is not a tupleexpected %d arguments, got %zdcan't apply this %s to %s object%s assignment: '%s' deallocator differs from '%s'%s assignment: '%s' object layout differs from '%s'can't delete __class__ attribute__class__ must be set to new-style class, not '%s' object__class__ assignment: only for heap typesargument to __format__ must be unicode or str__getnewargs__ should return a tuple, not '%.200s'copy_reg._slotnames didn't return a list or Nonesuper(type, obj): obj must be an instance or subtype of type__get__(None, None) is invalidcannot create '%.100s' instancesCannot create a consistent method resolution order (MRO) for bases%s.__cmp__(x,y) requires y to be a '%s', not a '%s', <%s object>>object.__init__() takes no parameterstype inequality comparisons not supported in 3.xOut of memory interning slotdef names__init__() should return None, not '%.200s'__coerce__ didn't return a 2-tuple%s should return bool or int, returned %s__new__() called with non-type 'self'%s.__new__(): not enough arguments%s.__new__(X): X is not a type object (%s)%s.__new__(%s): %s is not a subtype of %s%s.__new__(%s) is not safe, use %s.__new__()type.__init__() takes no keyword argumentstype.__init__() takes 1 or 3 argumentscan only assign string to %s.__name__, not '%s'object.__new__() takes no parametersCan't instantiate abstract class %s with abstract methods %sthis __dict__ descriptor does not support '%.200s' objects__dict__ must be set to a dictionary, not a '%.200s'method cannot be both class and staticOverriding __eq__ blocks inheritance of __hash__ in 3.xtype '%.100s' participates in gc and is a base type but has inappropriate tp_free slotmultiple bases have instance lay-out conflicta new-style class can't have only classic basesmro() returned a non-class ('%.500s')mro() returned base with unsuitable layout ('%.500s')metaclass conflict: the metaclass of a derived class must be a (non-strict) subclass of the metaclasses of all its basestype '%.100s' is not an acceptable base typenonempty __slots__ not supported for subtype of '%s'__slots__ items must be strings, not '%.200s'__dict__ slot disallowed: we already got one__weakref__ slot disallowed: either we already got one, or __itemsize__ != 0type object '%.50s' has no attribute '%.400s'can't set attributes of built-in/extension type '%s'can only assign tuple to %s.__bases__, not %scan only assign non-empty tuple to %s.__bases__, not ()%s.__bases__ must be tuple of old- or new-style classes, not '%s'x.__getslice__(i, j) <==> x[i:j] Use of negative indices is not supported.x.__setitem__(i, y) <==> x[i]=yx.__delitem__(y) <==> del x[y]x.__setslice__(i, j, y) <==> x[i:j]=y Use of negative indices is not supported.x.__delslice__(i, j) <==> del x[i:j] Use of negative indices is not supported.x.__divmod__(y) <==> divmod(x, y)x.__rdivmod__(y) <==> divmod(y, x)x.__pow__(y[, z]) <==> pow(x, y[, z])y.__rpow__(x[, z]) <==> pow(x, y[, z])x.__coerce__(y) <==> coerce(x, y)x[y:z] <==> x[y.__index__():z.__index__()]x.__getattribute__('name') <==> x.namex.__setattr__('name', value) <==> x.name = valuex.__delattr__('name') <==> del x.namex.next() -> the next value, or raise StopIterationdescr.__get__(obj[, type]) -> valuex.__init__(...) initializes x; see x.__class__.__doc__ for signaturedictionary for instance variables (if defined)list of weak references to the object (if defined)T.__new__(S, ...) -> a new object with type S, a subtype of Tmro() -> list return a type's method resolution order__subclasses__() -> list of immediate subclasses__sizeof__() -> size of object in memory, in bytesthe type of the instance invoking super(); may be Nonenn__abstractmethods__copy_reg__getstate____slotnames___slotnames__newobj__(Oi)_reduce_ex|i:__reduce__|i:__reduce_ex__can't set %s.__module__can't delete %s.__module__nnO__new__, NULL>__delete____set____getattribute__(n)__get__<%s.%s object at %p><%s '%s.%s'><%s '%s'>can't set %s.__name__can't delete %s.__name__O!|O:superThis object has no __dict__bases must be typesduplicate base class %s[O]mrotype() takes 1 or 3 argumentsSO!O!:type__slots____slots__ must be identifiers__weakref__can't set %s.__bases__can't delete %s.__bases__The most base typex.__len__() <==> len(x)x.__add__(y) <==> x+yx.__mul__(n) <==> x*nx.__rmul__(n) <==> n*xx.__getitem__(y) <==> x[y]x.__contains__(y) <==> y in xx.__iadd__(y) <==> x+=yx.__imul__(y) <==> x*=yx.__radd__(y) <==> y+xx.__sub__(y) <==> x-yx.__rsub__(y) <==> y-xx.__mul__(y) <==> x*yx.__rmul__(y) <==> y*xx.__div__(y) <==> x/yx.__rdiv__(y) <==> y/xx.__mod__(y) <==> x%yx.__rmod__(y) <==> y%xx.__neg__() <==> -xx.__pos__() <==> +xx.__abs__() <==> abs(x)x.__nonzero__() <==> x != 0x.__invert__() <==> ~xx.__lshift__(y) <==> x< y< x>>yx.__rrshift__(y) <==> y>>xx.__and__(y) <==> x&yx.__rand__(y) <==> y&xx.__xor__(y) <==> x^yx.__rxor__(y) <==> y^xx.__or__(y) <==> x|yx.__ror__(y) <==> y|xx.__int__() <==> int(x)x.__long__() <==> long(x)x.__float__() <==> float(x)x.__oct__() <==> oct(x)x.__hex__() <==> hex(x)x.__iadd__(y) <==> x+yx.__isub__(y) <==> x-yx.__imul__(y) <==> x*yx.__idiv__(y) <==> x/yx.__imod__(y) <==> x%yx.__ipow__(y) <==> x**yx.__ilshift__(y) <==> x< x>>yx.__iand__(y) <==> x&yx.__ixor__(y) <==> x^yx.__ior__(y) <==> x|yx.__floordiv__(y) <==> x//yx.__rfloordiv__(y) <==> y//xx.__truediv__(y) <==> x/yx.__rtruediv__(y) <==> y/xx.__ifloordiv__(y) <==> x//yx.__itruediv__(y) <==> x/yx.__str__() <==> str(x)x.__repr__() <==> repr(x)x.__cmp__(y) <==> cmp(x,y)x.__hash__() <==> hash(x)x.__call__(...) <==> x(...)x.__lt__(y) <==> x x<=yx.__eq__(y) <==> x==yx.__ne__(y) <==> x!=yx.__gt__(y) <==> x>yx.__ge__(y) <==> x>=yx.__iter__() <==> iter(x)descr.__set__(obj, value)descr.__delete__(obj)__subclasses____basicsize____itemsize____flags____weakrefoffset____base____dictoffset____mro__helper for pickle__subclasshook__default object formatterthe object's class__thisclass__the class invoking super()__self_class__555$5{55weakly-referenced object no longer existscannot create weak reference to '%s' object:__call__weak object has gone awayObjects/weakrefobject.cweakrefweakproxyweakcallableproxy(u#)padded string is too longn|O&:rjustn|O&:ljustn|O&:centerObjects/unicodeobject.cz.%dxmlcharrefreplace&#%d;ordinal not in range(256)asciiordinal not in range(128)charmapcharacter maps to truncated inputunicode_internaltruncated dataunexpected end of dataillegal UTF-16 surrogateillegal encodingutf16utf32invalid start byteinternal errorinvalid continuation byteutf8truncated \uXXXXrawunicodeescape\Uxxxxxxxx out of rangeunexpected special charactercode pairs are not supportedutf7unterminated shift sequencetruncated \uXXXX escapetruncated \xXX escapetruncated \UXXXXXXXX escapeillegal Unicode characterunicodedataucnhash_CAPImalformed \N character escape\ at end of string|Oss:unicodeO|OO:findCan't initialize 'unicode'EncodingMapisdecimalisnumericcannot use unicode as modifiable bufferaccessing non-existent unicode segmentcan't resize shared unicode objectsunichr() arg not in range(0x110000) (wide Python build)string indices must be integerscharacter mapping must be in range(0x%lx)character mapping must return integer, None or unicodecharacter mapping must be in range(256)character mapping must return integer, None or strposition %zd from error handler out of boundsinvalid decimal Unicode stringcharacter mapping must be in range(65536)illegal code point (> 0x10FFFF)codepoint not in range(0x110000)Negative size passed to PyUnicode_FromStringAndSizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/partial character in shift sequencenon-zero padding bits in shift sequenceend of string in escape sequenceunknown Unicode character name\N escapes not supported (can't load unicodedata module)decoder did not return an unicode object (type=%.400s)decoding Unicode is not supporteddecoding bytearray is not supportedcoercing to Unicode: need string or buffer, %.80s found%s arg must be None, unicode or strThe fill character cannot be converted to UnicodeThe fill character must be exactly one character long'in ' requires string as left operandUnicode unequal comparison failed to convert both arguments to Unicode - interpreting them as being unequalUnicode equal comparison failed to convert both arguments to Unicode - interpreting them as being unequalsequence item %zd: expected string or Unicode, %.80s found%c arg not in range(0x110000) (wide Python build)O!n;encoding error handler must return (unicode, int) tupleO!n;translating error handler must return (unicode, int) tupleO!n;decoding error handler must return (unicode, int) tupleReturn the size (in bytes) of this objectҋ^ܡȡppppppppџmYE 1XH8(h@zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz z}]zzzzzzzzzzzz?zzzzzzzzzzzzzzzB' f`>>X>>>>>>>P>H>>@zppp::ppp::##:: 0   yy  9 Oaa 88 A ~+*](*=EG** ** .. 22 33 66 55 11 // -- )) )) ++ ** )) && '' %% TT&%@?   P 0 ` }y}  A JJ VV dd pp ~~ A A A    }y}(   !"#$"%&"""'()*+,-."/01234567"""""""""""""""""""""""""""""""""89:;<=>?@ABCDEFGHIJKLMNOPQRS"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""T"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""T  !"#$%&'%()*+++,,-./....0120120123012456789:;<=>?@AABCADEFGFHIJKLLLMNNOP......................................Q..)))RSSSTUUVWWWXYZZ[\]^^^_`abcdefg666hhhhhhhhhhhhhhhhccccccccccccccccijkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk.llllllllllllllllllllllllllllllllllllll........................................................................ .......................................................................................................... ............................................................................................................................. ...................................................................................................... .......................................................... .................................................. ....................................................... .................................................... ...................................... ...................................................... ..................................................... ..................................................... .......................................................................................................................... ...................................... ... ............................................................................................ .............................. mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................nopqrs.........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................  ............................................................................................................................................................... .................................................................................... ............................................................................. ................................ .................................... ... ...........................................................................................tu.....................................vwxxxxxxxxyyyyyyyyxxxxxxyyyyyyxxxxxxxxyyyyyyyyxxxxxxxxyyyyyyyyxxxxxxyyyyyyxxxxyyyyxxxxxxxxyyyyyyyyzz{{{{||}}~~xxxxxxxxxxxxxxxxxxxxxxxxxxyyxxyyxxdyygnopqrsnopqrs.....^^^^^^^^^^^^^^^^^^^^^....^^^nopqrsnopqrsnopqrsnopqrsnopqrsnopqrsnopqrskkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkklllllllllllllllllllllllllllllllllllllllllllllll........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... ..........................................................................................................................................................  ....................................................................................................... .............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... ..........................................................................................................................................n...............................................................................................................^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^     .....................................................................................................................................................................................................................................................>> ABzD@F0A@@APA@`ApA@AAAAAHCD@FAAAAAAAAA@@?@?>AC;E`FABB BBBBB@ BCzE@G$B(B,B0B4B8Balwaysonceonceregistryshowwarning__warningregistry____main__O|On:warnOOOi|OOO:warn_explicit__loader__categorymodule_globalsstacklevel_warnings.filters must be a list_warnings.filters item %zd isn't a 5-tuple_warnings.default_action not foundUnrecognized action (%s) in warnings.filters: %sfunctions overriding warnings.showwarning() must support the 'line' argumentwarnings.showwarning() must be set to a function or methodcategory is not a subclass of WarningO()O()Ounknown operator foundunknown expr_context found_fieldseither 0 or _attributesasname_asts(O){sOss}ModuleInteractiveExpressionSuiteFunctionDefClassDefReturnDeleteAugAssignPrintForWhileWithRaiseTryExceptTryFinallyAssertImportImportFromExecGlobalExprPassBreakContinueBoolOpBinOpUnaryOpLambdaIfExpDictListCompGeneratorExpYieldCompareCallAttributeSubscriptListTupleexpr_contextDelAugLoadAugStoreParamExtSliceIndexboolopoperatorMultModPowLShiftRShiftBitOrBitXorBitAndFloorDivunaryopInvertUAddUSubcmpopNotEqLtLtEGtGtEIsIsNotNotInexcepthandlerExceptHandlerkeywordaliasinvalid integer value: %.400svarargkwargunknown boolop foundleftunknown unaryop foundoperandorelseeltgeneratorsunknown cmpop foundopscomparatorskeywordsstarargskwargsctxeltscol_offsetdimstargetifsdecorator_listtargetsdestnlcontext_exproptional_varsinsttbackhandlersfinalbodyPyCF_ONLY_AST62047__version__field id is required for Namefield s is required for Strfield n is required for Numfield test is required for Ifinvalid boolean value: %.400sexpected %s node, got %.400s_ast.AST??@@ @0@@@P@`@p@@@?@AA A0A@A@Ih iijjhnk0lm8mPmHolhsrrpq(rxrnXt@t(ttsssstpti@0xЄpP(8xXhP%.400s constructor takes %s%zd positional argument%sexpected some sort of operator, but got %.400sexpected some sort of expr_context, but got %.400sfield name is required for aliasrequired field "name" missing from aliasfield arg is required for keywordfield value is required for keywordfield target is required for comprehensionfield iter is required for comprehensionfield value is required for Indexfield ctx is required for Tuplefield ctx is required for Listfield ctx is required for Namefield value is required for Subscriptfield slice is required for Subscriptfield ctx is required for Subscriptfield value is required for Attributefield attr is required for Attributefield ctx is required for Attributefield value is required for Reprfield func is required for Callfield left is required for Comparefield elt is required for GeneratorExpfield elt is required for ListCompfield test is required for IfExpfield body is required for IfExpfield orelse is required for IfExpfield args is required for Lambdafield body is required for Lambdafield op is required for UnaryOpfield operand is required for UnaryOpfield left is required for BinOpfield op is required for BinOpfield right is required for BinOpfield op is required for BoolOprequired field "lineno" missing from exprrequired field "col_offset" missing from exprexpected some sort of boolop, but got %.400srequired field "op" missing from BoolOpBoolOp field "values" must be a list, not a %.200srequired field "values" missing from BoolOprequired field "left" missing from BinOprequired field "op" missing from BinOprequired field "right" missing from BinOpexpected some sort of unaryop, but got %.400srequired field "op" missing from UnaryOprequired field "operand" missing from UnaryOprequired field "args" missing from Lambdarequired field "body" missing from Lambdarequired field "test" missing from IfExprequired field "body" missing from IfExprequired field "orelse" missing from IfExpDict field "keys" must be a list, not a %.200srequired field "keys" missing from DictDict field "values" must be a list, not a %.200srequired field "values" missing from Dictrequired field "elt" missing from ListCompListComp field "generators" must be a list, not a %.200srequired field "generators" missing from ListComprequired field "elt" missing from GeneratorExpGeneratorExp field "generators" must be a list, not a %.200srequired field "generators" missing from GeneratorExprequired field "left" missing from CompareCompare field "ops" must be a list, not a %.200sexpected some sort of cmpop, but got %.400srequired field "ops" missing from CompareCompare field "comparators" must be a list, not a %.200srequired field "comparators" missing from Comparerequired field "func" missing from CallCall field "args" must be a list, not a %.200srequired field "args" missing from CallCall field "keywords" must be a list, not a %.200srequired field "arg" missing from keywordrequired field "value" missing from keywordrequired field "keywords" missing from Callrequired field "value" missing from Reprrequired field "n" missing from Numrequired field "s" missing from Strrequired field "value" missing from Attributerequired field "attr" missing from Attributerequired field "ctx" missing from Attributerequired field "value" missing from Subscriptrequired field "slice" missing from Subscriptrequired field "ctx" missing from Subscriptrequired field "id" missing from Namerequired field "ctx" missing from NameList field "elts" must be a list, not a %.200srequired field "elts" missing from Listrequired field "ctx" missing from ListTuple field "elts" must be a list, not a %.200srequired field "elts" missing from Tuplerequired field "ctx" missing from Tupleexpected some sort of expr, but got %.400sarguments field "args" must be a list, not a %.200srequired field "args" missing from argumentsarguments field "defaults" must be a list, not a %.200srequired field "defaults" missing from argumentsrequired field "target" missing from comprehensionrequired field "iter" missing from comprehensioncomprehension field "ifs" must be a list, not a %.200srequired field "ifs" missing from comprehensionExtSlice field "dims" must be a list, not a %.200srequired field "dims" missing from ExtSlicerequired field "value" missing from Indexexpected some sort of slice, but got %.400sfield value is required for Exprfield body is required for Execfield module is required for ImportFromfield test is required for Assertfield context_expr is required for Withfield test is required for Whilefield target is required for Forfield iter is required for Forfield target is required for AugAssignfield op is required for AugAssignfield value is required for AugAssignfield value is required for Assignfield name is required for ClassDeffield name is required for FunctionDeffield args is required for FunctionDefrequired field "lineno" missing from stmtrequired field "col_offset" missing from stmtrequired field "name" missing from FunctionDefrequired field "args" missing from FunctionDefFunctionDef field "body" must be a list, not a %.200srequired field "body" missing from FunctionDefFunctionDef field "decorator_list" must be a list, not a %.200srequired field "decorator_list" missing from FunctionDefrequired field "name" missing from ClassDefClassDef field "bases" must be a list, not a %.200srequired field "bases" missing from ClassDefClassDef field "body" must be a list, not a %.200srequired field "body" missing from ClassDefClassDef field "decorator_list" must be a list, not a %.200srequired field "decorator_list" missing from ClassDefDelete field "targets" must be a list, not a %.200srequired field "targets" missing from DeleteAssign field "targets" must be a list, not a %.200srequired field "targets" missing from Assignrequired field "value" missing from Assignrequired field "target" missing from AugAssignrequired field "op" missing from AugAssignrequired field "value" missing from AugAssignPrint field "values" must be a list, not a %.200srequired field "values" missing from Printrequired field "nl" missing from Printrequired field "target" missing from Forrequired field "iter" missing from ForFor field "body" must be a list, not a %.200srequired field "body" missing from ForFor field "orelse" must be a list, not a %.200srequired field "orelse" missing from Forrequired field "test" missing from WhileWhile field "body" must be a list, not a %.200srequired field "body" missing from WhileWhile field "orelse" must be a list, not a %.200srequired field "orelse" missing from Whilerequired field "test" missing from IfIf field "body" must be a list, not a %.200srequired field "body" missing from IfIf field "orelse" must be a list, not a %.200srequired field "orelse" missing from Ifrequired field "context_expr" missing from WithWith field "body" must be a list, not a %.200srequired field "body" missing from WithTryExcept field "body" must be a list, not a %.200srequired field "body" missing from TryExceptTryExcept field "handlers" must be a list, not a %.200srequired field "lineno" missing from excepthandlerrequired field "col_offset" missing from excepthandlerExceptHandler field "body" must be a list, not a %.200srequired field "body" missing from ExceptHandlerexpected some sort of excepthandler, but got %.400srequired field "handlers" missing from TryExceptTryExcept field "orelse" must be a list, not a %.200srequired field "orelse" missing from TryExceptTryFinally field "body" must be a list, not a %.200srequired field "body" missing from TryFinallyTryFinally field "finalbody" must be a list, not a %.200srequired field "finalbody" missing from TryFinallyrequired field "test" missing from AssertImport field "names" must be a list, not a %.200srequired field "names" missing from Importrequired field "module" missing from ImportFromImportFrom field "names" must be a list, not a %.200srequired field "names" missing from ImportFromrequired field "body" missing from ExecGlobal field "names" must be a list, not a %.200srequired field "names" missing from Globalrequired field "value" missing from Exprexpected some sort of stmt, but got %.400sfield body is required for ExpressionModule field "body" must be a list, not a %.200srequired field "body" missing from ModuleInteractive field "body" must be a list, not a %.200srequired field "body" missing from Interactiverequired field "body" missing from ExpressionSuite field "body" must be a list, not a %.200srequired field "body" missing from Suiteexpected some sort of mod, but got %.400sziassignment to Nonecan't assign to ()generator expressionyield expressionlist comprehensionliteralcomparisonreprconditional expressionlambdadeletecan't %s %sfunction callPython/ast.cstring to parse is too longutf-32-be\U%02x%02x%02x%02xinvalid comp_op: %sinvalid comp_op: %s %sunhandled factor: %dunhandled expr: %dlogic error in count_gen_forsmore than 255 argumentskeyword argument repeated(unicode error) %s(unicode error) unknown errorunhandled atom %dNon-statement found: %d %d unexpected import name: %dinvalid augassign: %sunexpected flow_stmt: %dfinallymalformed 'try' statement(zlOO)assignment to True or False is forbidden in 3.xunexpected expression in assignment %d (line %d)invalid comp_op: has %d childrenparenthesized arg with defaultnon-default argument follows default argumenttuple parameter unpacking has been removed in 3.xparenthesized argument names are invalid in 3.xunexpected node in varargslist: %d @ %dGenerator expression must be parenthesized if not sole argumentnon-keyword arg after keyword argonly named arguments may follow *expressionlambda cannot contain assignmentkeyword can't be an expressionlogic error in count_list_forsbackquote not supported in 3.x; use repr()augmented assignment to generator expression not possibleaugmented assignment to yield expression not possibleillegal expression for augmented assignmentassignment to yield expression not possibletrailing comma not allowed without surrounding parenthesesUnexpected node-type in from-importunknown import statement: starts with command '%s'poorly formed 'exec' statement: %d parts to statementimproper number of parts to 'assert' statement: %dunhandled small_stmt: TYPE=%d NCH=%d unexpected token in 'if' statement: %swrong number of tokens for 'while' statement: %dwrong number of children for 'except' clause: %dencoding declaration in Unicode stringinvalid node %d for PyAST_FromNodeL (08@HP`p000/I*0/..H.P-I*,,,,,,+*I*I*I*I*I*I*I*I*I*I*I*I*I*I*I*I*I*I*I*I*I*I**EPFFPGEEEXHEHEEEEEEEEEEEEEEE8IF`RRQQQQQQQQQRRQQQQQQQQQQQQQQQQQQQQQQQSQQQQQQQQXXWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW![Z5Z#Z\XWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWFX+_Xx^]e]aXXXXX*`XXXXXXX]]A]eTd$dcrdBi.iLfLfLfLfLfhhqh   vars(): no locals!?i:unichrsumO|OOi:sortedsetattrdelattrd|i:roundfunctoolsreducel:chrchr() arg not in range(256)[raw_]input[raw_]input: lost sys.stdin[raw_]input: lost sys.stdout[raw_]input: input too long|OOO:printpow%s() arg is an empty sequenceissubclassisinstanceS:interns;embedded '\0' in input linehasattrgetattrO|O:formatfilters|O!O:execfilelocals must be a mappingevalglobals must be a dictdivmodOss|ii:compilecompile(): unrecognised flagsexecsinglecoerce() not supported in 3.xcoerceapplys|OOOi:__import__anybinhashlenoctraw_inputreloadnumberndigitssepdont_inheritfromlistzip argument #%zd must support iterationoct() argument can't be converted to oct__oct__ returned non-string (type %.200s)hex() argument can't be converted to hex__hex__ returned non-string (type %.200s)vars() argument must have __dict__ attributerange() integer %s argument expected, got %s.__int__ should return int objectord() expected string of length 1, but %.200s foundord() expected a character, but string of length %zd foundsum() can't sum strings [use ''.join(seq) instead]In 3.x, reload() is renamed to imp.reload()reduce() not supported in 3.x; use functools.reduce()%.200s object is not an iteratorrange() step argument must not be zerorange() result has too many itemsl;range() requires 1-3 int argumentsll|l;range() requires 1-3 int argumentssep must be None, str or unicode, not %.200send must be None, str or unicode, not %.200s%s() got an unexpected keyword argumentmap() requires at least two argsmap(None, ...) not supported in 3.x; use list(...)callable() not supported in 3.x; use isinstance(x, collections.Callable)iter(v, w): v must be callablecan't intern subclass of stringhasattr(): attribute name must be stringgetattr(): attribute name must be stringcan't filter str to str: __getitem__ returned different typecan't filter unicode to unicode: __getitem__ returned different typefilter(): unsubscriptable tupleexecfile() not supported in 3.x; use exec()globals must be a real dict; try eval(expr, {}, mapping)eval must be given globals and locals when called without a framecode object passed to eval() may not contain free variableseval() arg 1 must be a string or code objectcompile() arg 3 must be 'exec', 'eval' or 'single'compile() expected string without null bytesapply() not supported in 3.x; use func(*args, **kwargs)apply() arg 2 expected sequence, found %sapply() arg 3 expected dictionary, found %s constructorargument list must be a tupleceval: tstate mix-upceval: orphan tstatelost sys.displayhookbad RAISE_VARARGS opargno locals'finally' pops bad exception__metaclass__name '%.200s' is not definedno locals when deleting %stoo many values to unpackno locals when loading %s__import__ not found__all__cannot import name %.230sXXX lineno: %d, opcode: %d unknown opcodenon-keyword exactlyat mostat leastthreading_after_forkslice indices must be integers or None or have an __index__ methodkeyword list must be a dictionarymaximum recursion depth exceeded%sPyEval_SaveThread: NULL tstatePyEval_ReleaseThread: NULL thread statePyEval_ReleaseThread: wrong thread statePyEval_AcquireThread: NULL new thread statePyEval_AcquireThread: non-NULL old thread state%.200s%s got multiple values for keyword argument '%.200s'local variable '%.200s' referenced before assignmentinvalid argument to DUP_TOPX (bytecode corruption?)raise: arg 3 must be a traceback or Noneexceptions must be old-style classes or derived from BaseException, not %sexceptions must derive from BaseException in 3.xglobals and locals cannot be NULLexec: arg 1 must be a string, file, or code objectexec: arg 2 must be a dictionary or Noneexec: arg 3 must be a mapping or Nonecode object passed to exec may not contain free variablesError when calling the metaclass bases %sno locals found when storing %sneed more than %d value%s to unpackglobal name '%.200s' is not definedfree variable '%.200s' referenced before assignment in enclosing scopecatching of string exceptions is deprecatedcatching classes that don't inherit from BaseException is not allowed in 3.xno locals found during 'import *'from-import-* object has no __dict__ and no __all__%.200s() takes no arguments (%d given)%.200s() takes exactly one argument (%d given)%.200s%.200s argument after ** must be a mapping, not %.200s%.200s%.200s argument after * must be a sequence, not %200serror return without exception setPyEval_EvalCodeEx: NULL globals%.200s() takes %s %d %sargument%s (%d given)%.200s() keywords must be strings%.200s() got an unexpected keyword argument '%.400s'%.200s() got multiple values for keyword argument '%.400s'PyEval_RestoreThread: NULL tstatem'yield' outside function'return' outside function'break' outside loopparam invalid in simple sliceextended sliceinvalid subscript kind %dno symtablesuite should not be possible(On)(u#n)handler must be callableencodingsOsincrementaldecoderincrementalencoderargument must be callablestrict_errorsignore_errorsxmlcharrefreplace_errorsbackslashreplacebackslashreplace_errorsdon't know how to handle %.400s in error callbackcodec must pass exception instancecan't initialize codec error registrycan't initialize codec registryunknown error handler name '%.400s'no codec search functions registered: can't find encodingcodec search functions must return 4-tuplesdecoder must return a tuple (object,integer)encoder must return a tuple (object,integer)Implements the 'strict' error handling, which raises a UnicodeError on coding errors.Implements the 'ignore' error handling, which ignores malformed data and continues.Implements the 'replace' error handling, which replaces malformed data with a replacement marker.Implements the 'xmlcharrefreplace' error handling, which replaces an unencodable character with the appropriate XML character reference.Implements the 'backslashreplace' error handling, which replaces an unencodable character with a backslashed escape sequence.0123456789abcdefException in ignored sOO(is)bad argument type for built-in operationPyErr_NewException: name must be module.classbad argument to internal function%s:%d: bad argument to internal function__hello____phello____phello__.spamPYTHONINSPECTPYTHONUNBUFFEREDPython %s %s __main__ not frozennested_scopesabsolute_importbracesnot a chancefuture feature %.100s is not definedstring or read-only buffer(unspecified)impossiblegroup id must be integeruser id must be integerPython/getargs.cat least at most must be %.50s, not %.50s%.200s() argument %d, item %dargument %.256sconvertible to a buffercontiguous bufferis not retrievableintegerintegerintegerintegerintegerintegerintegerintegerlongintegerfloatfloatcomplex(unicode conversion error)(cleanup problem)string without null bytesstring or None(buffer is NULL)(encoding failed)(buffer_len is NULL)(memory error)(buffer overflow)cannot convert raw buffersread-write bufferstring or pinned buffer%s: '%s'keywords must be stringsexcess ')' in getargs formatmissing ')' in getargs format%.200s%s takes no argumentsbad format string: %.200sstring or single-segment read-only bufferUnmatched right paren in format stringUnmatched left paren in format stringgroup id is not in range(-1, 2^32-1)user id is not in range(-1, 2^32-1)%s does not take keyword arguments%s expected %s%zd arguments, got %zdunpacked tuple should have %s%zd elements, but has %zdmust be %d-item sequence, not %.50smust be sequence of length %d, not %dunsigned byte integer is less than minimumunsigned byte integer is greater than maximumsigned short integer is less than minimumsigned short integer is greater than maximumstring without null bytes or None(unknown parser marker combination)string or unicode or text buffer(encoder failed to return a string)encoded string without NULL bytessingle-segment read-write bufferinvalid use of 't' format characterstring or read-only character buffer%s%s takes at most %d argument%s (%d given)More keyword list entries (%d) than format specifiers (%d)Argument given by name ('%s') and position (%d)Required argument '%s' (pos %d) not foundmore argument specifiers than keyword list entries (remaining format:'%s')'%s' is an invalid keyword argument for this functiontoo many tuple nesting levels in argument format string%.200s%s takes at least one argumentold style getargs format uses new featuresnew style getargs format but argument is not a tuple%.150s%s takes %s %d argument%s (%ld given),,,,,,,,,,,,,,,,,,,,,,,,d,d,,,dd,dd,,P,,,d,d,,,,,,,,,,,,dddd,dd,dd,d,,,,,,,9999 099999989p999999999999 9Ph999999ph9998 [GCC 4.4.7 20120313 (Red Hat 4.4.7-23)]linux22.6.6%.80s (%.80s) %.80ssingle_inputfile_inputeval_inputdecoratordecoratorsdecoratedfuncdefparametersvarargslistfpdeffplistsimple_stmtsmall_stmtexpr_stmtaugassignprint_stmtdel_stmtpass_stmtflow_stmtbreak_stmtcontinue_stmtreturn_stmtyield_stmtraise_stmtimport_nameimport_fromimport_as_namedotted_as_nameimport_as_namesdotted_as_namesdotted_nameglobal_stmtexec_stmtassert_stmtcompound_stmtif_stmtwhile_stmtfor_stmttry_stmtwith_stmtwith_varexcept_clausesuitetestlist_safeold_testold_lambdefor_testand_testnot_testcomp_opxor_exprand_exprshift_exprarith_exprtermfactorpoweratomlistmakertestlist_gexptrailersubscriptlistsubscriptsliceopexprlisttestlistdictmakerclassdefarglistlist_iterlist_forlist_ifgen_itergen_forgen_iftestlist1encoding_declyield_exprpassbreakcontinueraiseassertelifwhileexceptnotyield(0TL !$ (0TL !$  !$  (0TL !$  TL !$ @ @ @@ TL !$  !$ !$ ? $  !$  !$ NullImporter()s:NullImporterempty pathnameexisting directorybad/closed file objectNon-code object in %.200spath_importer_cachepath_hooksmodule name is too longmeta_pathsO__init__.py# trying %s No module named %.200sss|O!:load_dynamics:is_frozens:is_builtinimpSEARCH_ERRORPY_SOURCEPY_COMPILEDC_EXTENSIONPY_RESOURCEPKG_DIRECTORYC_BUILTINPY_FROZENPY_CODERESOURCEIMP_HOOKs:get_frozen_objects:new_modulessiOs(ssi)s|O:find_module# %s has bad magic # %s has bad mtime # %s matches %s import %s # from %s dont_write_bytecodewb# can't create %s # can't write %s # wrote %s ss|O!:load_sourceBad magic number in %.200sss|O!:load_compiled packageimport %s # frozen%s __path__s:init_frozenimport %s # builtin import hook without loaderimport %s # directory %s ss:load_packagesOs(ssi):load_moduleinvalid file open mode %.200sEmpty module nameModule name too long__package__ set to non-stringPackage name too longCould not set __package__s:init_builtin# clear __builtin__._ sys# clear sys.%s # restore sys.%s # cleanup __main__ # cleanup[1] %s # cleanup[2] %s # cleanup sys # cleanup __builtin__ not holding the import lock[s]gobject{OO}OOOOi# installing zipimport hook zipimport# can't import zipimport # installed zipimport hook .pyc.pyoimp.NullImporterNull importer objectget_magicget_suffixeslock_heldacquire_lockrelease_lockps1ps2exitfunclast_typelast_valuelast_tracebackfloat_info__stdin____stdout____stderr__Always return Nonesys.meta_path must be a list of import hooksfull frozen module name too longNo frozen submodule named %.200ssys.path must be a list of directory namessys.path_hooks must be a list of import hookssys.path_importer_cache must be a dictNot importing directory '%.*s': missing __init__.pyNo such frozen object named %.200sExcluded frozen object named %.200sPyImport_GetModuleDict: no module dictionary!Loaded module %.200s not found in sys.modulesimport: deleting existing key insys.modules failedunable to get file status from '%s'import %s # precompiled from %s frozen object %.200s is not a code objectimport %s # previously loaded (%s) _PyImport_FixupExtension: module %.200s not loadedCannot re-init internal module %.200sfile object required for import (type code %d)Purported %s module %.200s not found%s module %.200s not properly initializedDon't know how to import %.200s (type code %d)load_module arg#2 should be a file or NonePyImport_ReloadModule: no modules_reloading dictionary!reload() argument must be modulereload(): module %.200s not in sys.modulesreload(): parent %.200s not in sys.modulesItem in ``from list'' not a stringImport by filename is not supported.Attempted relative import in non-packageAttempted relative import beyond toplevel packageParent module '%.200s' not found while handling absolute importParent module '%.200s' not loaded, cannot perform relative importFailed to import %.200s because the import lockis held by another thread.initializing sys.meta_path, sys.path_hooks, path_importer_cache, or NullImporter failed# can't import zipimport.zipimporter Can't initialize import file table.nHII`InHHIHHnHHdynamic module does not define init function (init%.200s)dynamic module not initialized properlyimport %s # dynamically loaded from %s marshalrecursion limit exceededbad marshal dataNULL object in marshal datas#:loadsOO|i:dumpunmarshallable objectO|i:dumpsEOF read where object expectedcannot unmarshal code objects in restricted execution modeXXX readobject called with exception set marshal.load() arg must be filemarshal.dump() 2nd arg must be fileobject too deeply nested to marshalzyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyy~yyXzyyyyzyyyz {@{yyyyyyX{yyyyyyy|yy@|~yx}yy}yyyyyy@~@~yy|0ypunmatched paren in formatmodule '%s' has no __dict__Unmatched paren in formatHHHHHHHHNHHHHHHHHHHHHHHHHHHHHHHNHHNHHNHHHNHHHHHHHHHHHHHNHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHqqqqPpHppPyModule_AddObject() needs module as first argPyModule_AddObject() needs non-NULL valueInterpreter not initialized (version mismatch?)module functions cannot set METH_CLASS or METH_STATICstring too long for Python stringNULL object passed to Py_BuildValuebad format char passed to Py_BuildValue  UUUU?3333*$I$qtEUUU;$I8^Cy 0 ,d! p= ^B{ I$ B|uPqunexpected binary operation %d on a constantunexpected unary operation %d on a constantIIIIIIIIIIIIIBr~rHPyThreadState_Get: no current threadCouldn't create autoTLSkey mappingPyThreadState_Delete: NULL tstatePyThreadState_Delete: NULL interpPyThreadState_Delete: invalid tstatePyThreadState_Delete: small circular list(!) and tstate not found.PyThreadState_Delete: circular list(!) and tstate not found.PyThreadState_DeleteCurrent: no current tstatePyThreadState_Delete: tstate is still currentPyInterpreterState_Delete: invalid interpPyInterpreterState_Delete: remaining threadsPyThreadState_Clear: warning: thread still has a frame auto-releasing thread-state, but no thread-state for this threadThis thread state must be current when releasingCouldn't create thread-state for new threadCan't initialize threads for interpreterFatal Python error: %s invalid tokenexpected an indented blockunexpected indentinvalid syntaxunexpected unindentunexpected EOF while parsingexpression too longunknown decode errorerror=%d unknown parsing error(sO)O(ziiz) File "", line ^ PYTHONHOMEcan't create __main__ module_shutdownError in sys.exitfunc: excepthookError in sys.excepthook: Original exception was: sys.excepthook is missing Bad magic number in .pyc fileBad code object in .pyc file>>> ... modulesPYTHONDEBUGPYTHONVERBOSEPYTHONOPTIMIZEPYTHONDONTWRITEBYTECODEPYTHONHASHSEEDPYTHONIOENCODINGCannot set codeset of stdinCannot set codeset of stdoutCannot set codeset of stderrpythonEOF while scanning triple-quoted string literalEOL while scanning string literalinconsistent use of tabs and spaces in indentationunindent does not match any outer indentation leveltoo many levels of indentationunexpected character after line continuation characterPy_EndInterpreter: thread is not currentPy_EndInterpreter: thread still has a framePy_EndInterpreter: not the last threadcan't add __builtins__ to __main__python: Can't reopen .pyc file 'import site' failed; traceback: 'import site' failed; use -v for traceback Py_NewInterpreter: call Py_Initialize firstPy_Initialize: can't make first interpreterPy_Initialize: can't make first threadPy_Initialize: can't init framesPy_Initialize: can't init intsPy_Initialize: can't init bytearrayPy_Initialize: can't make modules dictionaryPy_Initialize: can't make modules_reloading dictionaryPy_Initialize: can't initialize __builtin__Py_Initialize: can't initialize builtins dictPy_Initialize: can't initialize sysPy_Initialize: can't initialize sys dictx0Ppnegative argument not allowed/dev/urandom not foundFailed to open /dev/urandomFailed to read %zi bytes from /dev/urandomPYTHONHASHSEED must be "random" or an integer in range [0; 4294967295]Failed to read bytes from /dev/urandomreadonly attributerestricted attributeTruncation of value to charTruncation of value to shortbad memberdescr type for %sbad memberdescr typecan't delete numeric/char attributeattribute value type must be boolTruncation of value to unsigned charTruncation of value to unsigned shortWriting negative value into unsigned fieldxPx@`! 8!P!`!p!x x ! !! !!contains a nested function with free variablesimport * is not allowed in function '%.100s' because it is %sunqualified exec is not allowed in function '%.100s' it %sfunction '%.100s' uses import * and bare exec, which are illegal because it %sduplicate argument '%s' in function definitioninvalid expression in parameter listimport * only allowed at module level'return' with argument inside generatorname '%.400s' is assigned to before global declarationname '%.400s' is used prior to global declarationthis compiler does not handle Suitesunknown symbol table entryis a nested functionname '%s' is local and globalgenexprsymtable entrysymbolschildrenoptimizednested_=`>>>>0?`??0@@AAA=_=_==>0>==DM(MLLhJHJ@NI`KJLhI8HGGPGFF(EEi:setdlopenflagsi:setcheckintervalOO!:call_tracing|i:_getframecall stack is not deep enoughi:setrecursionlimits:setdefaultencodingO|O:getsizeoflost __builtin__no mem for sys.argvcan't assign sys.argv-cno mem for sys.path insertionsys.path.insert(0) failed... truncatedUnversioned directoryexported__displayhook____excepthook__hexversionCPython(ssz)subversionfinaliiisiversion_infoapi_versioncopyrightplatformexecutableexec_prefixmaxsizemaxintpy3kwarningmaxunicodebuiltin_module_nameslittlebyteorderwarnoptionscan't create sys.pathcan't assign sys.pathcallstats_clear_type_cache_current_framesexc_infoexc_cleargetdefaultencodinggetdlopenflagsgetfilesystemencodinggetrefcountgetrecursionlimitgetcheckintervalsetprofilegetprofilesettracegettracesys.flagsc_callc_exceptionc_return-dpy3k_warning-3division_warning-Qdivision_new-Qnewinspect-iinteractiveoptimize-O or -OO-Bno_user_site-sno_site-Signore_environment-Etabcheck-t or -ttverbose-v-Ubytes_warning-bhash_randomization-Rrecursion limit must be positiveType %.100s doesn't define __sizeof__sys.exc_clear() not supported in 3.x; use except clausesPython error: is a directory, cannot continue Python/traceback.ctracebacklimittb_nexttb_frametb_lastitb_lineno File "%.500s", line %d, in %.500s Traceback (most recent call last): ----help--version-J is reserved for Jython Unknown option: -%c -X is reserved for implementation-specific arguments Argument expected for the -%c option .0Format specifier missing precisionInvalid conversion specificationSign not allowed in string format specifierAlternate form (#) not allowed in string format specifier'=' alignment not allowed in string format specifierUnknown format code '%c' for object of type '%.200s'Unknown format code '\x%x' for object of type '%.200s'Alternate form (#) not allowed in float format specifierPrecision not allowed in integer format specifierSign not allowed with integer format specifier 'c'%%.%zd%cPPPPPPP   ./%-.255sinit%.200sdlopen("%s", %x); unknown dlopen() errormodule.sosem_postsem_waitsem_trywaitsem_destroysem_inittls find_key: small circular list(!)tls find_key: circular list(!)posixpwd_sre_codecs_symtablegcbuffer overflow in getpath.c's joinpath()Could not find platform independent libraries Could not find platform dependent libraries Consider setting $PYTHONHOME to [:] Not enough memory for dynamic PYTHONPATH. Using default static PYTHONPATH. PYTHONPATHos.pyModules/SetupLib/usrlib/python00.ziplib/lib-dynload:plat-linux2:lib-tk:lib-oldTry `python -h' for more information. Could not import runpy module Could not access runpy._run_module_as_main Could not create arguments for runpy._run_module_as_main not enough memory to copy -c argumentnot enough memory to copy -m argument-Q option should be `-Qold', `-Qwarn', `-Qwarnall', or `-Qnew' only Type "help", "copyright", "credits" or "license" for more information.%s: can't open file '%s': [Errno %d] %s %s: '%s' is a directory, cannot continue usage: %s [option] ... [-c cmd | -m mod | file | -] [arg] ... Options and arguments (and corresponding environment variables): -B : don't write .py[co] files on import; also PYTHONDONTWRITEBYTECODE=x -c cmd : program passed in as string (terminates option list) -d : debug output from parser; also PYTHONDEBUG=x -E : ignore PYTHON* environment variables (such as PYTHONPATH) -h : print this help message and exit (also --help) -i : inspect interactively after running script; forces a prompt even if stdin does not appear to be a terminal; also PYTHONINSPECT=x -m mod : run library module as a script (terminates option list) -O : optimize generated bytecode slightly; also PYTHONOPTIMIZE=x -OO : remove doc-strings in addition to the -O optimizations -R : use a pseudo-random salt to make hash() values of various types be unpredictable between separate invocations of the interpreter, as a defense against denial-of-service attacks -Q arg : division options: -Qold (default), -Qwarn, -Qwarnall, -Qnew -s : don't add user site directory to sys.path; also PYTHONNOUSERSITE -S : don't imply 'import site' on initialization -t : issue warnings about inconsistent tab usage (-tt: issue errors) -u : unbuffered binary stdout and stderr; also PYTHONUNBUFFERED=x see man page for details on internal buffering relating to '-u' -v : verbose (trace import statements); also PYTHONVERBOSE=x can be supplied multiple times to increase verbosity -V : print the Python version number and exit (also --version) -W arg : warning control; arg is action:message:category:module:lineno -x : skip first line of source, allowing use of non-Unix forms of #!cmd -3 : warn about Python 3.x incompatibilities that 2to3 cannot trivially fix file : program read from script file - : program read from stdin (default; interactive mode if a tty) arg ...: arguments passed to program in sys.argv[1:] Other environment variables: PYTHONSTARTUP: file executed on interactive startup (no default) PYTHONPATH : '%c'-separated list of directories prefixed to the default module search path. The result is sys.path. PYTHONHOME : alternate directory (or %c). The default module search path uses %s. PYTHONCASEOK : ignore case in 'import' statements (Windows). PYTHONIOENCODING: Encoding[:errors] used for stdin/stdout/stderr. PYTHONHASHSEED: if this variable is set to 'random', the effect is the same as specifying the -R option: a random value is used to seed the hashes of str, unicode, buffer and datetime objects. It can also be set to an integer in the range [0,4294967295] to get hash values with a predictable seed. /pythonX.Xrunpy_run_module_as_main(si)3bBc:dEhiJm:OQ:RsStuUvVW:xX?warnallPython %s PYTHONNOUSERSITEPython %s on %s PYTHONSTARTUPCould not open PYTHONSTARTUP WWWWWWWWWWWWWWWWWWWWWWWWW`@W0 WWWWWWWWWWWWWWWWWWWWWWWWPgc: %.100s <%.100s %p> %zduncollectablegc: done, %.4fs elapsedgarbage collectiongarbageDEBUG_STATSDEBUG_COLLECTABLEDEBUG_UNCOLLECTABLEDEBUG_INSTANCESDEBUG_OBJECTSDEBUG_SAVEALLDEBUG_LEAKinvalid generation(iii)i|ii:set_thresholdi:set_debugenabledisableisenabledget_debugget_countget_thresholdcollectget_objectsget_referrersget_referentsgc: %.100s <%.100s instance at %p> gc couldn't allocate "__del__"gc: collecting generation %d... gc: objects in each generation:gc: done, %zd unreachable, %zd uncollectablegc couldn't create gc.garbage listunexpected exception during garbage collectionthread.errorLockTyperelease unlocked lock|i:acquire|n:stack_sizesize not valid: %zd bytesno current thread identcan't allocate lockstart_new_threadfirst arg must be callable2nd arg must be a tuplecan't start new threadthread.local.%pthread._localThread-local datastart_newallocate_lockallocateexit_threadinterrupt_mainget_identthread.lockreleaselocked_locklockedLocal-data dictionarysize must be 0 or a positive valuesetting stack size not supportedoptional 3rd arg must be a dictionaryUnhandled exception in thread started by Initialization arguments are not supportedCouldn't get thread-state dictionary(iO)SIG_DFLSIG_IGNNSIGdefault_int_handlerSIGHUPSIGINTSIGQUITSIGILLSIGTRAPSIGIOTSIGABRTSIGFPESIGKILLSIGBUSSIGSEGVSIGSYSSIGPIPESIGALRMSIGTERMSIGUSR1SIGUSR2SIGCLDSIGCHLDSIGPWRSIGIOSIGURGSIGWINCHSIGPOLLSIGSTOPSIGTSTPSIGCONTSIGTTINSIGTTOUSIGVTALRMSIGPROFSIGXCPUSIGXFSZSIGRTMINSIGRTMAXITIMER_REALITIMER_VIRTUALITIMER_PROFsignal.ItimerErrori:getsignalsignal number out of rangeii:siginterrupti:set_wakeup_fdinvalid fdiO:signali:getitimerid|d:setitimeri:alarmpauseset_wakeup_fd only works in main threadsignal only works in main threadsignal handler must be signal.SIG_IGN, signal.SIG_DFL, or a callable object$tIn:urandomi:WSTOPSIGi:WTERMSIGi:WEXITSTATUSii:makedevi:minori:majorO&:sysconfsO&:pathconfiO&:fpathconfO&:confstrunexpected NULL from tmpnam_r|zz:tempnamw+bs:statvfsi:fstatvfsi:WIFEXITEDi:WIFSIGNALEDi:WIFSTOPPEDi:WCONTINUEDi:WCOREDUMP|i:stat_float_timesi:strerrors:unsetenvss:putenv%s=%siO:ftruncates|ii:mknods|i:mkfifo(ii)i:isattyi|sii:fstatis*:writeii:readiOi:lseekii:dup2i:dupii:closerangei:closeet:removeet:rmdiret:chrootet:chdiretet:symlinketet:renameetet:linket:statet:lstateti|iii:tcsetpgrpi:tcgetpgrpii:setpgidi:getsidii:waitpidNiresourcestruct_rusageNiNii:wait4i:wait3i:getpgidtoo many groupsO&:setgidO&O&O&:setegidO&:seteuidO&:setuids|si:popenwtii:killpgii:kill(Ni)etOO:execveetO:execvi:_exitdddddetO:utime(sssss)i:umasks:systemet:readlinki:niceet|i:mkdirU:listdiret:listdiretO&O&:lchowniO&O&:chownetO&O&:chownii:fchmodeti:chmodi:ttynameeti:accessF_OKR_OKW_OKTMP_MAXWNOHANGWUNTRACEDO_RDONLYO_WRONLYO_RDWRO_NDELAYO_NONBLOCKO_APPENDO_DSYNCO_RSYNCO_SYNCO_NOCTTYO_CREATO_EXCLO_LARGEFILEO_ASYNCO_DIRECTO_DIRECTORYO_NOFOLLOWO_NOATIMEEX_OKEX_USAGEEX_DATAERREX_NOINPUTEX_NOUSEREX_NOHOSTEX_UNAVAILABLEEX_SOFTWAREEX_OSERREX_OSFILEEX_CANTCREATEX_IOERREX_TEMPFAILEX_PROTOCOLEX_NOPERMEX_CONFIGST_RDONLYST_NOSUIDST_NODEVST_NOEXECST_SYNCHRONOUSST_MANDLOCKST_WRITEST_APPENDST_NOATIMEST_NODIRATIMEST_RELATIMEconfstr_namessysconf_namesposix.stat_resultposix.statvfs_resultpathconf_namesenvironfchownctermidgetcwdgetcwduunameunlinkopenptyforkptygetegidgeteuidgetgidgetgroupsgetpidgetppidgetuidgetloginsetreuidsetregidsetgroupssetsidfdopenpipefchdirfsyncfdatasyncWIFCONTINUEDtmpfiletmpnamabortgetloadavgPC_ASYNC_IOPC_CHOWN_RESTRICTEDPC_FILESIZEBITSPC_LINK_MAXPC_MAX_CANONPC_MAX_INPUTPC_NAME_MAXPC_NO_TRUNCPC_PATH_MAXPC_PIPE_BUFPC_PRIO_IOPC_SOCK_MAXBUFPC_SYNC_IOPC_VDISABLESC_2_CHAR_TERMSC_2_C_BINDSC_2_C_DEVSC_2_C_VERSIONSC_2_FORT_DEVSC_2_FORT_RUNSC_2_LOCALEDEFSC_2_SW_DEVSC_2_UPESC_2_VERSIONSC_AIO_LISTIO_MAXSC_AIO_MAXSC_AIO_PRIO_DELTA_MAXSC_ARG_MAXSC_ASYNCHRONOUS_IOSC_ATEXIT_MAXSC_AVPHYS_PAGESSC_BC_BASE_MAXSC_BC_DIM_MAXSC_BC_SCALE_MAXSC_BC_STRING_MAXSC_CHARCLASS_NAME_MAXSC_CHAR_BITSC_CHAR_MAXSC_CHAR_MINSC_CHILD_MAXSC_CLK_TCKSC_COLL_WEIGHTS_MAXSC_DELAYTIMER_MAXSC_EQUIV_CLASS_MAXSC_EXPR_NEST_MAXSC_FSYNCSC_GETGR_R_SIZE_MAXSC_GETPW_R_SIZE_MAXSC_INT_MAXSC_INT_MINSC_IOV_MAXSC_JOB_CONTROLSC_LINE_MAXSC_LOGIN_NAME_MAXSC_LONG_BITSC_MAPPED_FILESSC_MB_LEN_MAXSC_MEMLOCKSC_MEMLOCK_RANGESC_MEMORY_PROTECTIONSC_MESSAGE_PASSINGSC_MQ_OPEN_MAXSC_MQ_PRIO_MAXSC_NGROUPS_MAXSC_NL_ARGMAXSC_NL_LANGMAXSC_NL_MSGMAXSC_NL_NMAXSC_NL_SETMAXSC_NL_TEXTMAXSC_NPROCESSORS_CONFSC_NPROCESSORS_ONLNSC_NZEROSC_OPEN_MAXSC_PAGESIZESC_PAGE_SIZESC_PASS_MAXSC_PHYS_PAGESSC_PIISC_PII_INTERNETSC_PII_INTERNET_DGRAMSC_PII_INTERNET_STREAMSC_PII_OSISC_PII_OSI_CLTSSC_PII_OSI_COTSSC_PII_OSI_MSC_PII_SOCKETSC_PII_XTISC_POLLSC_PRIORITIZED_IOSC_PRIORITY_SCHEDULINGSC_REALTIME_SIGNALSSC_RE_DUP_MAXSC_RTSIG_MAXSC_SAVED_IDSSC_SCHAR_MAXSC_SCHAR_MINSC_SELECTSC_SEMAPHORESSC_SEM_NSEMS_MAXSC_SEM_VALUE_MAXSC_SHARED_MEMORY_OBJECTSSC_SHRT_MAXSC_SHRT_MINSC_SIGQUEUE_MAXSC_SSIZE_MAXSC_STREAM_MAXSC_SYNCHRONIZED_IOSC_THREADSSC_THREAD_ATTR_STACKADDRSC_THREAD_ATTR_STACKSIZESC_THREAD_KEYS_MAXSC_THREAD_PRIORITY_SCHEDULINGSC_THREAD_PRIO_INHERITSC_THREAD_PRIO_PROTECTSC_THREAD_PROCESS_SHAREDSC_THREAD_SAFE_FUNCTIONSSC_THREAD_STACK_MINSC_THREAD_THREADS_MAXSC_TIMERSSC_TIMER_MAXSC_TTY_NAME_MAXSC_TZNAME_MAXSC_T_IOV_MAXSC_UCHAR_MAXSC_UINT_MAXSC_UIO_MAXIOVSC_ULONG_MAXSC_USHRT_MAXSC_VERSIONSC_WORD_BITSC_XBS5_ILP32_OFF32SC_XBS5_ILP32_OFFBIGSC_XBS5_LP64_OFF64SC_XBS5_LPBIG_OFFBIGSC_XOPEN_CRYPTSC_XOPEN_ENH_I18NSC_XOPEN_LEGACYSC_XOPEN_REALTIMESC_XOPEN_REALTIME_THREADSSC_XOPEN_SHMSC_XOPEN_UNIXSC_XOPEN_VERSIONSC_XOPEN_XCU_VERSIONSC_XOPEN_XPG2SC_XOPEN_XPG3SC_XOPEN_XPG4CS_LFS64_CFLAGSCS_LFS64_LDFLAGSCS_LFS64_LIBSCS_LFS64_LINTFLAGSCS_LFS_CFLAGSCS_LFS_LDFLAGSCS_LFS_LIBSCS_LFS_LINTFLAGSCS_PATHCS_XBS5_ILP32_OFF32_CFLAGSCS_XBS5_ILP32_OFF32_LDFLAGSCS_XBS5_ILP32_OFF32_LIBSCS_XBS5_ILP32_OFF32_LINTFLAGSCS_XBS5_ILP32_OFFBIG_CFLAGSCS_XBS5_ILP32_OFFBIG_LDFLAGSCS_XBS5_ILP32_OFFBIG_LIBSCS_XBS5_LP64_OFF64_CFLAGSCS_XBS5_LP64_OFF64_LDFLAGSCS_XBS5_LP64_OFF64_LIBSCS_XBS5_LP64_OFF64_LINTFLAGSCS_XBS5_LPBIG_OFFBIG_CFLAGSCS_XBS5_LPBIG_OFFBIG_LDFLAGSCS_XBS5_LPBIG_OFFBIG_LIBSst_modeprotection bitsst_inoinodest_devdevicest_nlinknumber of hard linksst_uiduser ID of ownerst_gidgroup ID of ownerst_sizetotal size, in bytesinteger time of last accessinteger time of last changest_atimest_mtimetime of last modificationst_ctimest_blksizeblocksize for filesystem I/Ost_blocksnumber of blocks allocatedst_rdevdevice type (if inode device)f_bsizef_frsizef_blocksf_bfreef_bavailf_filesf_ffreef_favailf_flagf_namemaxLoad averages are unobtainableunrecognized configuration nameconfiguration names must be strings or integerstmpnam is a potential security risk to your programtempnam is a potential security risk to your programstrerror() argument out of rangesetgroups argument must be a sequenceunable to determine login nameexecve() arg 2 must be a tuple or listexecve() arg 3 must be a mapping objectet;execve() arg 2 must contain only stringsexecve(): env.keys() or env.values() is not a lists;execve() arg 3 contains a non-string keys;execve() arg 3 contains a non-string valueexecv() arg 2 must be a tuple or listexecv() arg 2 must contain only stringsutime() arg 2 must be a tuple (atime, mtime)SC_THREAD_DESTRUCTOR_ITERATIONSCS_XBS5_ILP32_OFFBIG_LINTFLAGSCS_XBS5_LPBIG_OFFBIG_LINTFLAGSinteger time of last modification& .>ư>errorcodeENODEVENOCSIEHOSTUNREACHENOMSGEUCLEANEL2NSYNCEL2HLTENODATAENOTBLKENOSYSEPIPEEINVALEOVERFLOWEADVEINTREUSERSENOTEMPTYENOBUFSEPROTOEREMOTEENAVAILECHILDELOOPEXDEVE2BIGESRCHEMSGSIZEEAFNOSUPPORTEBADREHOSTDOWNEPFNOSUPPORTENOPROTOOPTEBUSYEWOULDBLOCKEBADFDEDOTDOTEISCONNENOANOESHUTDOWNECHRNGELIBBADENONETEBADEEBADFEMULTIHOPEUNATCHEPROTOTYPEENOSPCENOEXECEALREADYENETDOWNENOTNAMEACCESELNRNGEILSEQENOTDIRENOTUNIQEPERMEDOMEXFULLECONNREFUSEDEISDIREPROTONOSUPPORTEROFSEADDRNOTAVAILEIDRMECOMMESRMNTEREMOTEIOEL3RSTEBADMSGENFILEELIBMAXESPIPEENOLINKENETRESETETIMEDOUTENOENTEEXISTEDQUOTENOSTREBADSLTEBADRQCELIBACCEFAULTEFBIGEDEADLKENOTCONNEDESTADDRREQELIBSCNENOLCKEISNAMECONNABORTEDENETUNREACHESTALEENOSRENOMEMENOTSOCKESTRPIPEEMLINKERANGEELIBEXECEL3HLTECONNRESETEADDRINUSEEOPNOTSUPPEREMCHGEAGAINENAMETOOLONGENOTTYERESTARTESOCKTNOSUPPORTETIMEEBFONTEDEADLOCKETOOMANYREFSEMFILEETXTBSYEINPROGRESSENXIOENOPKGstruct_pwents:getpwnamO&:getpwuidgetpwallpwd.struct_passwdpw_nameuser namepw_passwdpasswordpw_uiduser idpw_gidgroup idpw_gecosreal namepw_dirhome directorypw_shellshell programgetpwnam(): name not found: %sgetpwuid(): uid not found: %luXH8 x((8p @`؝8XH0؟ȟΠΠΠΠΠΠΠΠxXΠΠΠΠΠΠΠΠΠΠΠΠΠ8تP(ЫЫp8p0ЬhبX@XX`hm mŵ'Ozpppppppppppppppp(HpppH 8`08`H@xxhx``:(1v PPPPPPPPPPPPPPPP PPPX  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~MAGICCODESIZEcannot copy this match objectOiO!|nOOinvalid SRE codepatterngroupindexexpected string or bufferbuffer has negative sizebuffer size mismatchO|nn:scannerno such group|O:groupsO|nn:findallO|n:splitO|nn:searchO|nn:match|O:groupdictspanlastindexlastgroupregsendpos_expand_subxOO|n:subnOO|n:sub_sre.SRE_Scanner_sre.SRE_Match_sre.SRE_Patterngetcodesizegetlowerfinditer__copy____deepcopy__maxsplitreplcannot deepcopy this pattern objectcannot copy this pattern objectcannot deepcopy this match objectmaximum recursion limit exceededinternal error in regular expression engines:lookup_errorsO:register_errorOnt#|z:charbuffer_encodes#|z:readbuffer_encodeU:charmap_builds*|zO:charmap_decodeO|zO:charmap_encodes*|z:ascii_decodeO|z:ascii_encodes*|z:latin_1_decodeO|z:latin_1_encodeO|z:raw_unicode_escape_encodeO|z:unicode_internal_encodeO|z:unicode_internal_decodes*|z:unicode_escape_decodeO|z:unicode_escape_encodes*|zii:utf_32_ex_decodeOnis*|zi:utf_32_be_decodes*|zi:utf_32_le_decodes*|zi:utf_32_decodeO|z:utf_32_be_encodeO|z:utf_32_le_encodeO|zi:utf_32_encodes*|zii:utf_16_ex_decodes*|zi:utf_16_be_decodes*|zi:utf_16_le_decodes*|zi:utf_16_decodeO|z:utf_16_be_encodeO|z:utf_16_le_encodeO|zi:utf_16_encodes*|zi:utf_7_decodeO|z:utf_7_encodes*|zi:utf_8_decodeO|z:utf_8_encodes#|z:escape_decodeS|z:escape_encodeO|ss:decodeO|ss:encodes:lookupregisterraw_unicode_escape_decodes*|z:raw_unicode_escape_decodezipimport.ZipImportError_zip_directory_caches:zipimporter.is_packagecan't find module '%.200s's|O:zipimporter.find_moduleslllllllbad local file header in %szipimport: can't read datazlibdecompress# zipimport: zlib %s s:zipimporter.get_sources:zipimporter.get_datazipimporter()s:zipimporterarchive path is emptyarchive path too longZip path name is too longcan't open Zip file: '%.200s'can't read Zip file: '%.200s'not a Zip file: '%.200s'siiiiiiinot a Zip file# trying %s%c%s bad pyc datas:zipimporter._get_filenames:zipimporter.get_codes:zipimporter.load_module%s%c%s%szipimport.zipimporterarchivezipimport: can not open file %scan't decompress data; zlib not available# zipimport: found %ld names in %s compiled module %.200s is not a code objectzipimport: no memory to allocate source bufferimport %s # loaded from Zip %s DEF_GLOBALDEF_LOCALDEF_PARAMDEF_STARDEF_DOUBLESTARDEF_INTUPLEDEF_FREEDEF_FREE_GLOBALDEF_FREE_CLASSDEF_IMPORTDEF_BOUNDTYPE_FUNCTIONTYPE_CLASSTYPE_MODULEOPT_IMPORT_STAROPT_EXECOPT_BARE_EXECGLOBAL_EXPLICITGLOBAL_IMPLICITCELLSCOPE_OFFSCOPE_MASKsss:symtablesymtable() arg 3 must be 'exec' or 'eval' or 'single'Return symbol and scope dictionaries used internally by compiler.;Z^ [4[d`[lt[[<[\[\l\\L\\L,]P]] ], ], ^<^x^\^^^  _\D_h__,_l_ ` 8`,X`L|``` a\4a`a| a!aL"a"$b<#Pb#|b$b&b<' c )@c)lcl4c4c\5c7Tf\?|f?fL@fZ4[X|[|[\\\\ \,l]X]^L^|^ _,_4L_T__<`l```8,a`Lc,dLdldg\g,hlij,j<4>`???<@l@0@X@x\AAB\BB<Bl\Cy8>z>,{>\{>{?L|(? }x?~?L?l<@܂|@@L@< A> ?L @@B\DT??@,@d,AA BB,,Cd|C> ? ED\EpEF GGHDLHhIII,K LLXL|M OZ`<],``$`Hcd ef fD|ghgg\h|hh,iHijjk\k8k\k\lmmnDnh|oo,p|p pHLqtqq\rrsDutlwA,Bh\GJJ4Kp N$A$lG%HD%lD>p>,>><>?,X??\??| @4@l@ @<@@,@|8A\AA|AA B\,BdB\BB B|(C<\C|CCCD(DXD,D|DDETEE|EF Fl\FF|F"F &8G<&\G&G<+G,G-4H0tH0H3H4I8HI,9lIl9I9I9I <J>8J ?XJ,?xJ?J @J@JA,KlAXKAKLBKBKBKBLBAB AxA  >AB AxA  >AB AxA  <>AB AxA  `,>AB AxA  H>AB AxA  d>AB AxA  >AB AxA  >AB AxA  >AB AxA ,8AB YT\ AC Dh AB JF{ AA  AF c AD\AB JFC AA y AF K A,AB JZX AH (t4AB AjA  L4AB AjA  p4AB AjA  4AB AjA  4AB AjA   4AB AjA   4AB AjA  $8 4AB AjA  HT 4AB AjA  lp 4AB AjA   4AB AjA , AB QT\ AC ,H!AB JWb AA L !AB BZ AA G n AA H Y AA E MAA 8d "AB RUc AB x AA H #iAB JYG AB  AF o AH 8 0%AB RUc AB x AA H(!%VAB J_S AH u AA C AE 8t!'AB JYr AG V AA 8!\(AB JHZ AH n AA 8!(AB YT\ AC  AH 8(")AB QT\ AC u AJ Hd"*8AB JV{ AA Z AE { AD 8"|+AB JV[ AA D AH"+PAB JVE AG e AB { AD <8#,AB JR| AD W AH R ATx#4-5AB JVs AA ^ AA x AG K AL ,#.iAB A| A G U A B D$\.AB JVM AG r AE Z A,H$.iAB A| A G U A B ,x$.AB C AAA H $$3rAB K^ A$$3DAB Kp A,$$4NAB C AAA H L(%D7AB C AAA D  AAA A g AAA F <x%9=AB C AAA G _ AAA A <%:5AB C AAA G _ AAA A ,%;>AB JWT AG ,(&=AB JFB AB 0X&>oAB JUV AG m A$&>+AM Q A J $&>UAB Ax A C $&?UAB Ax A C $'H?UAB Ax A C $,'?rAB AP A C $T'?vAB Ak A H $|'0@YAB JJ AT'h@AB O AB g AH m AB ] AB ,'AvAB Az A A tA  ,(0BIAB TpA 0P(\BAB AH A C d A C ,(BmAB Az A A kA (C/AB k 8(CAB JF` AD  AH 8)CbAB PB AB  AG ,L)0EAB P AD 8|) GLAB Px AD m AB ()4HwAB R]C A0)HAB RZq AG d A8*HAB I AAA E iAAA HT*IPAB JFi AC t AC O AH *JMAB AGA H*JAB R_P AC @ AA [ AB 0+lAB J_B AA 80>AB Pz AB o AH Tl>AB C AAA A P AAA E _ AAA F gAAA 8>H1AB EC AAA G EAAA  ?LTAB ANA  $?7AB AqA HH?AB C AAA L  AAA L m AAA A <?8AB JZn AJ  AA ,?AD DA AAA E <@x.AB CN AAA A @ AAA E 8D@hAB JFB AB Y A<@mAB C AAA F l AAA A (@AB Dm AA A (@AB D AA H ,AAB MzV AG HAD"AB ^ hAT0AB l $AdHAB Ad A A ,AaAB A~ A E WA 4A̴AB JD AF P AG $B4gAB B_AA 0@B|AB AC A H P A G ,tBصWAB Ao A D ]A $ByAB BqAA $B`3AB _ F J $BxAB IAA $CIAB JFt A$DCZAB IKAA $lCPVAB Ap A C ,C!AB JQGJ AH <CAB C[ AAA D \ AAA A ,DAB MWi AG <4D=AB J\h AF 2 AE 8tDAB R_a AB k AL DLBAB A|A  DxBAB A|A  DBAB A|A  EоBAB A|A  @EBAB A|A  dE(BAB A|A  ETBAB A|A  EBAB A|A  EBAB A|A  EؿBAB A|A  FBAB A|A  AB JW} AF N AA 8h?AB JTt AB N AA $Thx?[AB Jak A$|h?[AB Jak A$h?[AB Jak A$h @[AB Jak A hX@HAB ABA 4i@sAB JWc AH a A4Pi@dAB JTa AE Z A(iAAB JWd A4ihAaAB JTa AE W A,iAAB P AF $j CuAB BmAA DDjxCAB JF` AD e AB s A,jDfAB JWY AB 8jPDAB JTe AA S AD ,jDAB UPx AG $(kDEEAB Jv A$PklE?AB Jp A$xkE?AB Jp A$kE?AB Jp A$kE?AB Jp A<kE]AB JF\ AH V AA 00lFAB BZ AA G TAA 4dl8GlAB JTa AE b A,lpGAB P AF 8lIAB MS[ AA  AG mdJ!AB Y (mtJAB U HmtJAD O $hmtJZAB IKAA mJ"AB ^ 0mJfAB JCf AA l ADmJ\AB J]} AH S AD  A(,nLAB JCq AA $XnLWAB JH A(nLAB Bm AA D (n@MgAB Ba AA H HnN[AB JF AD  AB g AH $$oPAB H[ A A LoQHAB H{A $po,QZAB IKAA $odQ+AM Q A J  olQ;AB HjA  oQHAB H{A 0pQRAB JIk AF H A$9AB AsA  <>/AB AiA ,DH>GAB Ar A A MA (th>sAB CiAAA (>AB B AA F (̩p?fAB Jx AB (?vAB BP AA A ($@fAB BO AA B $PL@KAB JCy A,xt@vAB DA^ AAA G 8@cAB DAF AAA G GAAA <@~AB C AAA G T AAA A ,$8BAB QS^ AB <TCAB C AAA A ) AAA D <hEAB C AAA A A AAA D ,ԫGAB IESU AF <XHAB DD AAA E  AAA B ,D8P AB C AAA A HtYDAB F AAA G G AAA F y AAA D 8ZAB Os AB p AA 4`[AD PE AE j A 4[6AB ApA <X[AB CM AAA B k AAA B <t\qAB Cd AAA C  AAA D $ح^CAB Hh A D 4^AB Bg AA B Z AA D 8T_ AB E <XD_AD CBt AAA G d AAA A $_hAB A} A F 8,`AB JF{ AA J A(`qAB BL AA A ,(`AB A A D @A ,XDaZAB Ag A L `A 0taeAB Pb AJ c A4aAB BN AA C P AA F $hbMAB Ac A H (bXAB JZo A,HbvAB Ar A A e A B ,xcAB Ar A A e A B $cSAB JD A4аcAB JCt AC d AH4dAB C_ AAA H  AAA B nAAA <TeAB C AAA F e AAA H 8fzAB JF AB v AA ,бgAB CBxAAA <,hDAB C AAA H  AAA B D@AB AxA DwAB Je{ AB g AH a A,صdx0AB C AAA A 4dzAD Pg AC W A,@zAB JU~ AG 0p{AB AK A H v A A D|AB C AAA B _ AAA F ]AAA 4|?AB JYk AF  AA $$}_AB AA A B <L~AB Cz AAA E ] AAA A @~AB B AA D i AA E R AA D 8зAB JUd AA m AB H AB C AAA H X AAA E ] AAA H (XTAB JCj AE <AB CV AAA A g AAA F (ĸYAB JWs A0LAB CCA AAA B ,$AB C AAA H <TAD C$ AAA A j AAA C ,AB DA AAA H LĹ AB C AAA A  AAA A  AAA A <AB DCC AAA H I AAA D LT(WAB C AAA A  AAA A  AAA A <8AB JESf AD O AH LAB C AAA G a AAA D  AAA A 4=AB AwA  X=AB AwA  |=AB AwA  ܠ=AB AwA (ĻAD CAAA ,\AB C AAA F , _AB CBO AAA A ,PAD AvA ,8[AB Ar A A aA 88AB J^n AF  AB 00:AB AF A E h A G 8d:AB NYx AE X AG @;AB CA] AA B U AA A IAA 8h;AB CY AAA F WAAA  ; AB D  @;LAB AFA $d;NAB ECAA 0<AB IT AA F lAA l<"AB ^ $|AB AxA 8AB Ph AD @ AA (AB O ALD8aAB DAR AAA C x AAA E X AAA E X5AB q <xAB PI AC  AB (-AB AgA H4WAB C AAA A X AAA E [AAA <dHAB JFA AC  AA 0(`AB Md AC f A,T AB C AAA E H4AB F AAA C f AAA G  AAA F (TAB CAAA ,lAB C AAA D 8,AB P^ AF v AA ,ZAB Ac A H hA L AB Cf AAA A  AAA C  AAA F <l nAB C AAA C z AAA A 4 gAB JFs AA O AH ( AB JwU AF , AB Jdn AH 0@ loAB BO AA B TAA 4t gAB JFs AA O AH ( AB JwU AF , AB Jdn AH 0 DoAB BO AA B TAA ,< zAB C| AAA C l ,AB AfA ( AB D AA H ( pAB Dm AA A < D AB MsQ AC E AB ,( AB Ch AAA G ,X tFAB Ai A B TA   AB D ( pAD CdAAA H AB CA AAA F T AAA A G AAA F , ,[AB An A E aA 8P \AB Pv AF o AH 0 wAB BS AA F TAA $ aAB BYAA $ DaAB BYAA $hAB B`AA 08yAB J`k AG W A,l .AB CX AAA G ( AB CAAA < AB C AAA C  AAA A ( ^AB JT{ A,4AB JKX AG d AB D 0BAB Ii AA A GAA "AB ^ $SAD Ha A A $gAB B_AA ,(dAB CCA{AAA  XMAB AGA  |4AD AlA   4AB AnA ,(nAB DA\ AAA A 8h[AB DAD AAA A GAAA H0<AB F AAA A G AAA F y AAA D ,|[AB An A E aA @AB BU AA D P AA F x AA F ,lzAB Ap A C a A F $ MAB Ac A H 4HAB JCt AC d AH\{AB C AAA H N AAA A | AAA G 8AG Ce AAA E VAAA <:AB C AAA C ~ AAA A <H'AB C AAA C X AAA E @JAB B@ AA A V AA H y AA A 8AB P^ AF v AA 8DAB DAG AAA F vAAA  DFAB A@A 0hjAB JV\ AH ` A,AB CT AAA C <AB Cp AAA G W AAA F , PAB Jfc AA H< LAB JFB AB M AB Y AF L$ 4AB C> AAA A D AAA A m AAA H ("JAB EA}AAA (8"AB CvAAA ,0"AB DAAAA <`"-AB CB AAA F X AAA A #AB S #AB Y $#xAB T^AA (D$rAB ChAAA @4$AB Ha AA B p AA F F AA H ,x$AB DAAAA HD%AB OB AC K AD Z AE $%AB IAA `&6AB r <&AB D \p&AB T  |p&3AB AmA &AB M  &SAI K C &RB D & AB \  $&BAB A|A $H&'AB [ B F $p&AB Hu A G $'ZAB IKAA $'VAB Ap A C ,'AB A{ A H uA (D(_AG Jc AB $Dx(CAB IJk Al(AB X ( AB X ( AB X ( AB X ( AB X  ( AB X $,(+AD U F J 8T(AG JVA AF T A8(AG JVA AF T A P)6AG HdA ,l)AG JVV AA 0 )AB CCAM AAA F ,Th+AB MCSJ AG H,:AD ArA  d,\AB AVA 8,.AB Je AC M AB 4-AB Pw AE Q A(@ .AG Jc AB ,l.dAB JWh AA $.NAB Af A E 0/AB DA- AAA H t6PAB AJA <6AB JlV AH  AF \ 87AB AqA  <87AB AqA ,X8XAB A| A G NA ,8XAB A| A G NA @8AB JCh AG B AE [ ATH$9kAB U AE V AA \ AC P AG 8<:AB JFq AC q AA ,:@AB Ai A B NA , :AB JFG AE D< P;AB JkX AG r AE T A0 ;iAB M| AC W AD ;AB PE AG n AA ] AA $!|<~AB AM A F $(!<AB A A D ,P!|=AB Zl\ AB !<>uAB AoA  !>uAB AoA <!>AB DAZ AAA C G AAA A <"D?AB Cv AAA A ] AAA A (H"?zAB Jt AF ,t"@ AB JF AB ,"@AB DA AAA E 4"CsAG Jc AB n AA 0 #CAB AM A F j A A ,@#LDAB A} A F r A A 0p#DAB AD A G q A A ,#EAB DA] AAA H ,#E$AB J_b AA ($FdAD JPS AE 40$FkAD JNS AG ` AG 8h$4GAG JVN AA  AH 4$GkAD JNS AG ` AG ,$HyAB AG A D gA 8 %PHAB J]` AE R AE 4H%IkAD JNS AG ` AG 4%LIsAG Jc AB g AH 0%IAB Ap A C Y A F ,%0JAB JFo AE ,&K|AB J_] AA 8L&`KAG JVV AA | AC 8&KAB ZlY AE { AD 8&XLAB Pz AB W AH 4'LAB BF AA C p AA F ,8'MAB C AAA E ,h'MAB Cg AAA H 8'NAB JFN AF N AA ,'8OaAB JTX AF ,(xOAB J`[ AG H4(8P6AB JbV AB V AA Y AF 8(,QAB JPTg AG q A,(QAB JZj AF 0(pRwAB BT AA E TAA , )RAB Jbl AD DP),TAB Jby AG Z AE l AD)TAB Jby AG Z AE S AH) UjAB J_z AA Y AF U AB 8,*0VAB JZd AD Q AF ,h*VAB Jkz AE H*TW/AB J]r AC Z AE V AA $*8XAB Ar A A +XCAB A}A $0+XAB Ar A A X+tYJAB ADA  |+YJAB ADA  +YJAB ADA  +YJAB ADA  +$ZJAB ADA  ,PZJAB ADA  0,|ZJAB ADA  T,ZJAB ADA  x,ZJAB ADA  ,[JAB ADA  ,,[JAB ADA  ,X[JAB ADA  -[JAB ADA  ,-[JAB ADA  P-[CAB A}A  t-\CAB A}A  -4\CAB A}A  -`\CAB A}A  -\CAB A}A  .\CAB A}A  (.\CAB A}A  L.]CAB A}A  p.<]CAB A}A  .h]CAB A}A $.]AB Ar A A .^JAB ADA 8/H^KAB JF AA z AE $@/\_AB Ar A A $h/_AB AW A D 4/L`AB BZ AA G b AA A H/`AB J]r AC Z AE V AA 80aAB S[ AF C AD 8P0AB JZu AC ,L>AB JZu AC ,|>pAB JZu AC ,>AB JZu AC ,>0AB JZu AC , ?AB JZu AC ,AB OW AF  AC $T\h?[AB JL AL|\?AB C AAA A  AAA A v AAA A ,\`D AB C AAA A \@J AB X ,]@JNAB Az A A LA L]`J AB X ,l]`JAB C AAA D ,] Q^AB AE A F LA ,]PQNAB Az A A LA 8]pQAB YO AD  AC L8^SQAB C AAA G  AAA B  AAA C L^XRAB CW AAA H i AAA D F AAA G <^ZVAB C AAA B A AAA D <_]AB C AAA E n AAA A X_`BAB A|A <|_ aAB C AAA F * AAA C _dBAB A|A L_dAB C AAA H X AAA E  AAA A 0`li;AB AuA 4T`iAB JSr AE f AA (` j^AB Jn AD <`TjAB C AAA G P AAA A <`mZAG CC AAA G J AAA C L8apAB C AAA E  AAA A  AAA A av;AB AuA <avAB C AAA C  AAA A Ha~\AB P AE r AE Z AE 8b5AB AoA ,\bYAB JF` AD ,bpAB Az A A nA 0b0oAB BO AA B TAA 4blgAB JFs AA O AH ((cAB JwU AF 4TcHgAB JFs AA O AH (cAB JwU AF Tc$AB JY AF h AG h AG h AG HdAB JF AC x AG g AH T\dAB Jz AG _ AH V AA p AG 4drAB AB A A W A H HA HdІmAB I AAA A G AAA F N AAA A H8emAB I AAA A G AAA F N AAA A Pe5AB JR AB n AA T AC [ A$e3AB Z K A $f3AB Z K A $(f4(AB W F A @Pf<AB BV AA C m AA A P AA F 8fȊAB M] AH M A4flAB Bw AA B H AA F 4gAB Bw AA B D AA B 4@glAB Bw AA B H AA F 4xgAB Bw AA B D AA B ,glfAB J}k AB $gAB AK A H HhAB JT\ AB Z AE e AB 8ThAB JuE AH X AG <h'AB C AAA G ' AAA A h,AB AfA <hAB JT AD  AH 4iX,AB AfA HXidAB JT\ AB Z AE e AB 8iAB JuE AH X AG Hi_AB JT AB Z AE M AB <,jsAB C AAA A d AAA A ,ljAB JTr AD <jИAB C AAA B P AAA E ,j@gAB J^h AD , k"AB C AAA A >AB JUV AG ,x?AB JFe AG LxPAlAB C AAA C X AAA E p AAA A L AAA A ,AB CT AAA C htAB DA AAA E o AAA A c AAA G N AAA G L AAA A ,$(AB DA AAA C ,TAB Jb[ AE H(8AB C AAA A O AAA F K AAA B ,РAB Pj AB (uAB CCiAA 0,LAB IK] AK J A(`,AB CC AA D (AB CCt AA A ,<AB PQ AA <$AB DAg AAA F U AAA H @(AB Oj AC V AA m D(l AB CAAA (wAB Bj AA A ,ĢvAB C AAA H ,8 AB C AAA A 8$(AB JWU AF R AE ,`EAB JQIp AH X2AB C AAA G g AAA F  AAA G p AAA E 8AB Jiz AG M AB \( AB CCAC AAA H y AAA D G AAA F = AAA E <AD C AAA D b AAA A ȤtAB CC AAA D  AAA A  AAA E  AAA E ; AAA E  AAA E K AAA E K AAA E K AAA E ,p+"AB JZy AG <.AB CBz AAA C ^ AAA G ,AB C AAA E (>FAB B AA G @@AB JR AH U AB M AB ,\PAAB C AAA D ,B5AB QS AH CAD H CAG H 4CAB Jw AC y AA (4(DAB B AA D `DLH A D"AM S DLH A DLB J D5LP X ( EsAB M]D A ,`ENAB AHA 8PEAB JT AD P A FPAB R0PFAB DA AAA D  JAB H 4I~AB Jv\ AH T A 8DJ;AB AuA 4\`JvAB Jo\ AG T A J4AB AnA 4JAB Zv\ AH T A K;AB AuA ,8KeAB C AAA F ,DxL3AB C AAA D ,tMAB JQf AC 8MAB JQk AF a AA |N;AB AuA 0NwAB BW AA B TAA ,8NAB JP AE htOPAB AJA  OPAB AJA  OQAB AKA (PAB JNv A |PBAB A|A ,$P:AB C AAA B $TXDAB A^ A E ,|XAB J\d AB ,PYAB JWx AC Z(AB AbA < ZeAB C^ AAA A  AAA F @<\#AB A<\P\AB JZK AE # AD <]AB C< AAA C Q AAA D `a&AB A`A 0laAB Aq A B N A A 4a-AB AgA LXaAB C AAA D  AAA G L AAA A e;AB AuA  e<AB AvA <eAB C AAA H u AAA H 0h4AB AnA ,ThAB Ci AAA F i4AB AnA DiAB JVB AB i AF U A j;AB AuA  8j;AB AuA  8Tj<AB AvA $\pjAB Az A A <jAB C AAA A q AAA D $XlKAB ]i A,lQ AB C AAA H u&AB A`A ,@uiAB Cd AAA C <pvAB C AAA E e AAA A H|x|AB JFh AD  AB  AE 8}AB Cp AAA G aAAA (8$~AB JC AG <dpAG C AAA H f AAA G (AB Bx AA A (|AB B AA A 0@AB AzA 4 LAB BK AA F T AA B (XfAB BO AA B <!AB DA AAA D ^ AAA G ,>AB LT AC <AB DA( AAA E P AAA E D4ȇAB NPQ AE X AG V AH|0AB CCA` AAA C p AAA A tAAA 0AB D AA G JAA ,AB LF AA ,,0AB ^Vp AH 8\PAB S AF c AD ,ԋ AB CP AAA G ,TAB Og AF H&AB DAa AAA D h AAA E o AAA F 0DlAB DY AA F AAA <xԝAB Db AA E P AA F wAA ,d AB CCA AAA D <AB C6 AAA A C AAA B (d'RB R Ht'RB R ,h@AB Ah A C NA  =AB AwA  *AB AdA  6AB ApA  ج`AB AZA  ('AB AaA (L hAB J} AE xdJAB ADA  aAB A[A ,ܭAB DAQ AAA D ,LAB QT AF < AB JFXO AE p AG 0`̯AB B AA A NAA $HvAB AP A C ,AB DAQ AAA D ${AB AZ A A $hZAB Av A E 4<AB BJ AA G G AA G th'AB AaA  t'AB AaA  jAB AdA  ̳~AB AxA 8(IAB Jli AE m AA @<AB AYA  d8(AB AbA 0DAB BU AA D ~AA ,NAB JTc AC 6AD AnA  LAB AFA 44(}AB Jd] AA k A,lpsAB Cv AAA A ,AB JWa AB ,(AB C AAA G 0nAB JQs AF T A00LAB CCA  AAA B dؽ:AB AtA  :AB AtA 8AB JXK AG u AB %AB A_A  %AB A_A ,0̾ AB C? AAA A 0`|CAB GA AAA H $IAB JFt A$[AB H@ A D 8AB JTe AA S AD 8 ?AB JYx AA  AA ,\AB Cz AAA A , AB LK{ AB HTAB C AAA H r AAA C `AAA @RB e 8(MAB J[c AA  AD (diAB C_AAA ,LAD C AAA C ,3AB X`v AF LHAB C AAA A N AAA A  AAA A @-AB AgA 8dAB CCA AAA C iAAA ,\4AB JV\ AH (lAB D AA G <AB Cx AAA G Y AAA A <<#AB DFY AAA G a AAA D ,|AB IQ AG 0PAB DA: AAA C ,AB JVU AG <:AB LKf AG   AA P3AB AiA  t3AB AiA  4AB AnA  <AB AvA , AB JVY AC ,AB C AAA A @$LJ M `LH A ,AB UFp AA 7AB AqA ,8AB C^ AAA A ,nAB CT AAA C (4PAB JCk AD 0` AB JM AE j A$hEAB Am A F GAB AAA AG E  AD E  4AB AnA ,DdAB CT AAA C (tAB CuAAA ,LAB DA AAA H <AD X <AB S ,<AB V\ AD (@ KAB CAAAA  l0LAB AFA ,\AB Pl AH 4yAB Ov AG g A8DAB JT_ AG D D,4AB C. AAA A ,dH BAB Ad A G PA ,h BAB Ad A G PA , BAB Ad A G PA , :AB A^ A E PA $ &AM W 8D ;AB JTM AA  AH 1AB C AAA G R AAA C  AAA A L kAB CL AAA C K AAA A   AAA A @AB HsA 0@|AB JFu AG j A0tHtAB JFo AE j A#\B D #\B D ,@AB Gf A G FA  2AB M`A  <%AB A_A $`aAB MO A 4%AB A_A 0@oAB PI AC M A(|cAB JFN A %AB A_A ,0{AB Aq A B S A D `/AB AiA ,(AB JZz AF 0AB B} AA D WAA <$AB C AAA H ] AAA A <(AB C AAA H Y AAA A <hAB C AAA B T AAA A , iAB Cd AAA C 8D(AB JY@ AA u AA ((VAB JI~ A$@,)=AB Jn A hD)AAD AyA  p)(AB AbA (|)AB Bh AA A $+AB Al A G +FAB A@A  (+FAB A@A  L,2AB AlA  p,XAB ARA  X,JAB ADA  ,(AB AbA $,ZAB IKAA $,AB H[ A A (,0-AB JW A$X$.HAB Ad A A L.6AB ApA 0h.AB Ry AA m A0.iAB Rq AA _ A$ .yAB BqAA (4H/ZAB JCH A(`|/AB Bj AA G $00LAB Af A E X0(AB AbA  d0,AB AfA 4p0AB Jy AA m AB 440AB B] AA D  AA H ,l2AB C AAA A H3eAB C AAA F c AAA A u AAA A ,5AB JQa AH $6MAB J~ A4@6xAB JVo AE ^ A(x6AB CAAA  7+AG A`A ,7KAB A` A C aA  7?AB AyA 07RAB FB, AAA A P8DAB A~A ,t(9%AB JXM AE (:AB AYA ,$: AB C AAA H G1AB AkA  G,AB AfA $@GLAB J} A$hGvAB AM A F $AAA DlUAB MeX AB J AE b ADhVAB MeX AB J AE P A VVAB APA  W`AB AZA  DXWVAB APA  hWYAB ASA  WUAB AOA $ XpAB AV A E 4TXyAB MP AH K AX!LB N 0X!LB N PX!LB N ,pX|AB Ax A C \ A A 4YAB Jw AC u AB 8tYZAB JlX AF  AB , ZAB JlV AH <D H[AB JAX AA X AG 8 [AB JsX AG { AD 8 L\zAB JNG AE P A \QAB AKA 0 \AB DA AAA B ,T h^~AB JYp AA < ^eAB DA. AAA G T AAA A D _AB MeX AB K AD P A8 ``AB Je_ AF M AB 8H ` AB Jlk AC M AB , a6AB JsV AA 8 bAB JlX AF { AD 4 cAB JbU AC t AC 4( tcAB JlX AF | A8` cAB JeX AE t AC ( 0dJAB N[\ A( TdDAB DAxAAA 8 xdAB JoX AC } AB 0 d*LH Q P d*LH Q p  e*LH Q  e*LH Q < ,eAB JAX AA O AH  e*LH Q e*LH Q 0e*LH Q 8PeAB Mdf AE \ AC fHAB ABA  fHAB ABA <fAB JMX AE L AC ,gwAB A A D d A C ,DggAB Ax A C \ A C ,thwAB A A D d A C ,hh;AB Af A E EA ,xhgAB Ax A C \ A C 4hAB BF AA C Y AA E L<@iDAB DA AAA B j AAA C M AAA H (@kAB MsX A(kAB MlU A8(lAB JUM AH P A, |l;AB Af A E EA ,PlgAB Ax A C \ A C HlAB C AAA B U AAA H d AAA A 0noAB AB A A ] A B 0LnAB AM A F d A C 04nAB AM A F d A C 0hooAB AB A A ] A B 0@ooAB AB A A ] A B 0|ooAB AB A A ] A B ,oAB CE AAA D ,48qwAB A A D e A B ,dqwAB A A D e A B DqAB JNm AG Z AE i A 0r'AB AaA  N^n~λ޻.>N^n~μ޼.>N^n~ν޽.>N^n~ξ޾.>N^n~ο޿.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~      @\~ch@lpltly@  ĥȥХԥܥ &.8?FNWant\%2=HRWbool(x) -> bool Returns True when the argument x is true, False otherwise. The builtins True and False are the only two instances of the class bool. The class bool is a subclass of the class int, and cannot be subclassed. @@7`buffer(object [, offset[, size]]) Create a new buffer object which references the given object. The buffer will reference a slice of the target object from the start of the object (or at the specified offset). The slice will extend to the end of the target object (or with the specified size). r ``@@ `pbytearray(iterable_of_ints) -> bytearray. bytearray(string, encoding[, errors]) -> bytearray. bytearray(bytes_or_bytearray) -> mutable copy of bytes_or_bytearray. bytearray(memory_view) -> bytearray. Construct an mutable bytearray object from: - an iterable yielding integers in range(256) - a text string encoded using the specified encoding - a bytes or a bytearray object - any object implementing the buffer API. bytearray(int) -> bytearray. Construct a zero-initialized bytearray of the given length.B.__alloc__() -> int Returns the number of bytes actually allocated.Return state information for pickling.B.__sizeof__() -> int Returns the size of B in memory, in bytesB.append(int) -> None Append a single item to the end of B.B.center(width[, fillchar]) -> copy of B Return B centered in a string of length width. Padding is done using the specified fill character (default is a space).B.count(sub [,start [,end]]) -> int Return the number of non-overlapping occurrences of subsection sub in bytes B[start:end]. Optional arguments start and end are interpreted as in slice notation.B.decode([encoding[, errors]]) -> unicode object. Decodes B using the codec registered for encoding. encoding defaults to the default encoding. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a UnicodeDecodeError. Other possible values are 'ignore' and 'replace' as well as any other name registered with codecs.register_error that is able to handle UnicodeDecodeErrors.B.endswith(suffix [,start [,end]]) -> bool Return True if B ends with the specified suffix, False otherwise. With optional start, test B beginning at that position. With optional end, stop comparing B at that position. suffix can also be a tuple of strings to try.B.expandtabs([tabsize]) -> copy of B Return a copy of B where all tab characters are expanded using spaces. If tabsize is not given, a tab size of 8 characters is assumed.B.extend(iterable int) -> None Append all the elements from the iterator or sequence to the end of B.B.find(sub [,start [,end]]) -> int Return the lowest index in B where subsection sub is found, such that sub is contained within s[start,end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.bytearray.fromhex(string) -> bytearray Create a bytearray object from a string of hexadecimal numbers. Spaces between two numbers are accepted. Example: bytearray.fromhex('B9 01EF') -> bytearray(b'\xb9\x01\xef').B.index(sub [,start [,end]]) -> int Like B.find() but raise ValueError when the subsection is not found.B.insert(index, int) -> None Insert a single item into the bytearray before the given index.B.join(iterable_of_bytes) -> bytes Concatenates any number of bytearray objects, with B in between each pair.B.ljust(width[, fillchar]) -> copy of B Return B left justified in a string of length width. Padding is done using the specified fill character (default is a space).B.lstrip([bytes]) -> bytearray Strip leading bytes contained in the argument. If the argument is omitted, strip leading ASCII whitespace.B.partition(sep) -> (head, sep, tail) Searches for the separator sep in B, and returns the part before it, the separator itself, and the part after it. If the separator is not found, returns B and two empty bytearray objects.B.pop([index]) -> int Remove and return a single item from B. If no index argument is given, will pop the last value.B.remove(int) -> None Remove the first occurance of a value in B.B.replace(old, new[, count]) -> bytes Return a copy of B with all occurrences of subsection old replaced by new. If the optional argument count is given, only the first count occurrences are replaced.B.reverse() -> None Reverse the order of the values in B in place.B.rfind(sub [,start [,end]]) -> int Return the highest index in B where subsection sub is found, such that sub is contained within s[start,end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.B.rindex(sub [,start [,end]]) -> int Like B.rfind() but raise ValueError when the subsection is not found.B.rjust(width[, fillchar]) -> copy of B Return B right justified in a string of length width. Padding is done using the specified fill character (default is a space)B.rpartition(sep) -> (head, sep, tail) Searches for the separator sep in B, starting at the end of B, and returns the part before it, the separator itself, and the part after it. If the separator is not found, returns two empty bytearray objects and B.B.rsplit(sep[, maxsplit]) -> list of bytearray Return a list of the sections in B, using sep as the delimiter, starting at the end of B and working to the front. If sep is not given, B is split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). If maxsplit is given, at most maxsplit splits are done.B.rstrip([bytes]) -> bytearray Strip trailing bytes contained in the argument. If the argument is omitted, strip trailing ASCII whitespace.B.split([sep[, maxsplit]]) -> list of bytearray Return a list of the sections in B, using sep as the delimiter. If sep is not given, B is split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). If maxsplit is given, at most maxsplit splits are done.B.splitlines([keepends]) -> list of lines Return a list of the lines in B, breaking at line boundaries. Line breaks are not included in the resulting list unless keepends is given and true.B.startswith(prefix [,start [,end]]) -> bool Return True if B starts with the specified prefix, False otherwise. With optional start, test B beginning at that position. With optional end, stop comparing B at that position. prefix can also be a tuple of strings to try.B.strip([bytes]) -> bytearray Strip leading and trailing bytes contained in the argument. If the argument is omitted, strip ASCII whitespace.B.translate(table[, deletechars]) -> bytearray Return a copy of B, where all characters occurring in the optional argument deletechars are removed, and the remaining characters have been mapped through the given translation table, which must be a bytes object of length 256.B.zfill(width) -> copy of B Pad a numeric string B with zeros on the left, to fill a field of the specified width. B is never truncated.Private method returning an estimate of len(list(it)).6`&PAp0/9`@0`P `,+@xh`f *7:['L@@`#p+03;CpK0S[%$@=p$.P#o3C#  @`p`hctp"@n2` V@ y M ` UnB4Zk0-:p` `QPPPAOOPclassobj(name, bases, dict) Create a class object. The name must be a string; the second argument a tuple of classes, and the third a dictionary.instance(class[, dict]) Create an instance without calling its __init__() method. The class must be a classic class. If present, dict must be a dictionary or None.instancemethod(function, instance, class) Create an instance method object.  0pАA S`P@h0wxPA TuJ @on lkjApTc z``0`__@_eЋp0^^P^^]0U` @0edd@dcfcPccb`b`]]ba@P~|`{y     $  $6TC objects to be exported from one extension module to another C objects are used for communication between extension modules. They provide a way for an extension module to export a C interface to other extension modules, so that extension modules can use the Python import mechanism to link to one another.r0@code(argcount, nlocals, stacksize, flags, codestring, constants, names, varnames, filename, name, firstlineno, lnotab[, freevars[, cellvars]]) Create a code object. Not for the faint of heart.BD0@`P P &0 9$E(Q,]0i4q8<complex(real[, imag]) -> complex number Create a complex number from a real part and an optional imaginary part. This is equivalent to (real + imag*1j) where imag defaults to 0.complex.conjugate() -> complex Returns the complex conjugate of its argument. (3-4j).conjugate() == 3+4j.   `@@@0p0`  property(fget=None, fset=None, fdel=None, doc=None) -> property attribute fget is a function to be used for getting an attribute value, and likewise fset is a function for setting, and fdel a function for del'ing, an attribute. Typical use is to define a managed attribute x: class C(object): def getx(self): return self._x def setx(self, value): self._x = value def delx(self): del self._x x = property(getx, setx, delx, "I'm the 'x' property.") Decorators make defining new properties or modifying existing ones easy: class C(object): @property def x(self): return self._x @x.setter def x(self, value): self._x = value @x.deleter def x(self): del self._x Descriptor to change the getter on a property.Descriptor to change the setter on a property.Descriptor to change the deleter on a property.A`0.@A`0`@A` 0S P` APE @0@@g `A@v0 A` { A` ]%b_I 6@66` ^` s,iPz`o e`0]% b6  66enumerate(iterable[, start]) -> iterator for index, value of iterable Return an enumerate object. iterable must be another object that supports iteration. The enumerate object yields pairs containing a count (from start, which defaults to zero) and a value yielded by the iterable argument. enumerate is useful for obtaining an indexed list: (0, seq[0]), (1, seq[1]), (2, seq[2]), ...reversed(sequence) -> reverse iterator over values of the sequence Return a reverse iteratorPrivate method returning an estimate of len(list(it)).u`Ep[EPPqL&Python's standard exception class hierarchy. Exceptions found here are defined both in the exceptions module and the built-in namespace. It is recommended that user-defined exceptions inherit from Exception. See the documentation for the exception inheritance hierarchy. `@ `@ `@      `@ `@ `@^`E* 5.s`E*5.`E5.`E+5.`E@+ 5.E`+@ ;. `E#  5.@ `E+5.W  P3E+0@`@:.s  E 0@:.  E 0@:. `E 5. `E !5.+`E,5.'!`E send 'arg' into generator, return next yielded value or raise StopIteration.throw(typ[,val[,tb]]) -> raise exception in generator, return next yielded value or raise StopIteration.close(arg) -> raise GeneratorExit inside generator.Return the name of the generator's associated code object.j1@gfA_`c$@$$0ft1@c!d1c "`b"y11 1_"file(name[, mode[, buffering]]) -> file object Open a file. The mode can be 'r', 'w' or 'a' for reading (default), writing or appending. The file will be created if it doesn't exist when opened for writing or appending; it will be truncated when opened for writing. Add a 'b' to the mode for binary files. Add a '+' to the mode to allow simultaneous reading and writing. If the buffering argument is given, 0 means unbuffered, 1 means line buffered, and larger numbers specify the buffer size. The preferred way to open a file is with the builtin open() function. Add a 'U' to mode to open the file for input with universal newline support. Any line ending in the input file will be seen as a '\n' in Python. Also, a file so opened gains the attribute 'newlines'; the value for this attribute is one of None (no newline read yet), '\r', '\n', '\r\n' or a tuple containing all the newline types seen. 'U' cannot be combined with 'w' or '+' mode. readline([size]) -> next line from the file, as a string. Retain newline. A non-negative size argument limits the maximum number of bytes to return (an incomplete line may be returned then). Return an empty string at EOF.read([size]) -> read at most size bytes, returned as a string. If the size argument is negative or omitted, read until EOF is reached. Notice that when in non-blocking mode, less data than what was requested may be returned, even if no size parameter was given.write(str) -> None. Write string str to file. Note that due to buffering, flush() or close() may be needed before the file on disk reflects the data written.fileno() -> integer "file descriptor". This is needed for lower-level file interfaces, such os.read().seek(offset[, whence]) -> None. Move to new file position. Argument offset is a byte count. Optional argument whence defaults to 0 (offset from start of file, offset should be >= 0); other values are 1 (move relative to current position, positive or negative), and 2 (move relative to end of file, usually negative, although many platforms allow seeking beyond the end of a file). If the file is opened in text mode, only offsets returned by tell() are legal. Use of other offsets causes undefined behavior. Note that not all file objects are seekable.truncate([size]) -> None. Truncate the file to at most size bytes. Size defaults to the current file position, as returned by tell().tell() -> current file position, an integer (may be a long integer).readinto() -> Undocumented. Don't use this; it may go away.readlines([size]) -> list of strings, each a line from the file. Call readline() repeatedly and return a list of the lines so read. The optional size argument, if given, is an approximate bound on the total number of bytes in the lines returned.xreadlines() -> returns self. For backward compatibility. File objects now include the performance optimizations previously implemented in the xreadlines module.writelines(sequence_of_strings) -> None. Write the strings to the file. Note that newlines are not added. The sequence can be any iterable object producing strings. This is equivalent to calling write() for each string.flush() -> None. Flush the internal I/O buffer.close() -> None or (perhaps) an integer. Close the file. Sets data attribute .closed to True. A closed file cannot be used for further I/O operations. close() may be called more than once without error. Some kinds of file objects (for example, opened by popen()) may return an exit status upon closing.isatty() -> true or false. True if the file is connected to a tty device.__enter__() -> self.__exit__(*excinfo) -> None. Closes the file.3TpP$DiМ5 660c%3?y()%z*s3pn@+)3P+}.3{.30/^3@/4i@04pq14p1pp 2n`3 4i3*4n3%8c 34B4<=4Zk@K4u4ma4|4l893j jd9float(x) -> floating point number Convert a string or number to a floating point number, if possible.sys.floatinfo A structseq holding information about the float type. It contains low level information about the precision and internal representation. Please study your system's :file:`float.h` for more information.float.as_integer_ratio() -> (int, int) Returns a pair of integers, whose ratio is exactly equal to the original float and with a positive denominator. Raises OverflowError on infinities and a ValueError on NaNs. >>> (10.0).as_integer_ratio() (10, 1) >>> (0.0).as_integer_ratio() (0, 1) >>> (-.25).as_integer_ratio() (-1, 4)float.fromhex(string) -> float Create a floating-point number from a hexadecimal string. >>> float.fromhex('0x1.ffffp10') 2047.984375 >>> float.fromhex('-0x1p-1074') -4.9406564584124654e-324float.hex() -> string Return a hexadecimal representation of a floating-point number. >>> (-0.1).hex() '-0x1.999999999999ap-4' >>> 3.14159.hex() '0x1.921f9f01b866ep+1'float.__getformat__(typestr) -> string You probably don't want to use this function. It exists mainly to be used in Python's test suite. typestr must be 'double' or 'float'. This function returns whichever of 'unknown', 'IEEE, big-endian' or 'IEEE, little-endian' best describes the format of floating point numbers used by the C type named by typestr.float.__setformat__(typestr, fmt) -> None You probably don't want to use this function. It exists mainly to be used in Python's test suite. typestr must be 'double' or 'float'. fmt must be one of 'unknown', 'IEEE, big-endian' or 'IEEE, little-endian', and in addition can only be one of the latter two if it appears to match the underlying C reality. Overrides the automatic determination of C-level floating point type. This affects how floats are converted to and from binary strings.float.__format__(format_spec) -> string Formats the float according to format_spec.: @p07@A7;7A @ `PpL@@; `8[9_:';@@2;@;9<9p>` @@;AH;XAS;AW;A_;B;j;|;XB;xB;B;;F.__sizeof__() -> size of F in memory, in bytesh<A0@C`C D BD DDDD<D,D0D4DD PDD`function(code, globals[, name[, argdefs[, closure]]]) Create a function object from a code object and a dictionary. The optional name string overrides the name from the code object. The optional argdefs tuple specifies the default argument values. The optional closure tuple supplies the bindings for free variables.classmethod(function) -> method Convert a function to be a class method. A class method receives the class as implicit first argument, just like an instance method receives the instance. To declare a class method, use this idiom: class C: def f(cls, arg1, arg2, ...): ... f = classmethod(f) It can be called either on the class (e.g. C.f()) or on an instance (e.g. C().f()). The instance is ignored except for its class. If a class method is called for a derived class, the derived class object is passed as the implied first argument. Class methods are different than C++ or Java static methods. If you want those, see the staticmethod builtin.staticmethod(function) -> method Convert a function to be a static method. A static method does not receive an implicit first argument. To declare a static method, use this idiom: class C: def f(arg1, arg2, ...): ... f = staticmethod(f) It can be called either on the class (e.g. C.f()) or on an instance (e.g. C().f()). The instance is ignored except for its class. Static methods in Python are similar to those found in Java or C++. For a more advanced concept, see the classmethod builtin.@, AD$`MN@  H EE@  H pEH BhIc9IFIAINIZI6cI pI (|I  I  I I I 0 0Iint(x[, base]) -> integer Convert a string or number to an integer, if possible. A floating point argument will be truncated towards zero (this does not include a string representation of a floating point number!) When converting a string, use the optional base. It is an error to supply a base when converting a non-string. If base is zero, the proper base is guessed based on the string content. If the argument is outside the integer range a long object will be returned instead. @ /Q@/N`RR0377JP-,+*0*@('0%(%0&%$@$#0%/p/@#`0%0%K0%K90%#  new empty list list(iterable) -> new list initialized from iterable's itemscmp() wrapper for sort with custom keys.Object wrapper with a custom sort key.x.__getitem__(y) <==> x[y]L.__reversed__() -- return a reverse iterator over the listL.__sizeof__() -- size of L in memory, in bytesL.append(object) -- append object to endL.insert(index, object) -- insert object before indexL.extend(iterable) -- extend list by appending elements from the iterableL.pop([index]) -> item -- remove and return item at index (default last). Raises IndexError if list is empty or index is out of range.L.remove(value) -- remove first occurrence of value. Raises ValueError if the value is not present.L.index(value, [start, [stop]]) -> integer -- return first index of value. Raises ValueError if the value is not present.L.count(value) -> integer -- return number of occurrences of valueL.reverse() -- reverse *IN PLACE*L.sort(cmp=None, key=None, reverse=False) -- stable sort *IN PLACE*; cmp(x, y) -> -1, 0, 1Private method returning an estimate of len(list(it)).M qPop _H_E`U?AEn`_fMp@AP??@`M@nA?@``M DpBUM@DVC+Z+e`q>p` ms`y@tEf@c>zCH'Vdl`VpAV cVh W d`WCPxW#w`XL@`XE`Y`>YLVZA`Z0A`Z%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% %%%%%%%  !"#%%%%%%  !"#%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%long(x[, base]) -> integer Convert a string or number to a long integer, if possible. A floating point argument will be truncated towards zero (this does not include a string representation of a floating point number!) When converting a string, use the optional base. It is an error to supply a base when converting a non-string.ƇfPdgg77JмPP@P`еHRK 9@|R  new empty dictionary dict(mapping) -> new dictionary initialized from a mapping object's (key, value) pairs dict(iterable) -> new dictionary initialized as if via: d = {} for k, v in iterable: d[k] = v dict(**kwargs) -> new dictionary initialized with the name=value pairs in the keyword argument list. For example: dict(one=1, two=2)D.__contains__(k) -> True if D has a key k, else Falsex.__getitem__(y) <==> x[y]D.__sizeof__() -> size of D in memory, in bytesD.has_key(k) -> True if D has a key k, else FalseD.get(k[,d]) -> D[k] if k in D, else d. d defaults to None.D.setdefault(k[,d]) -> D.get(k,d), also set D[k]=d if k not in DD.pop(k[,d]) -> v, remove specified key and return the corresponding value. If key is not found, d is returned if given, otherwise KeyError is raisedD.popitem() -> (k, v), remove and return some (key, value) pair as a 2-tuple; but raise KeyError if D is empty.D.keys() -> list of D's keysD.items() -> list of D's (key, value) pairs, as 2-tuplesD.values() -> list of D's valuesD.update(E, **F) -> None. Update D from dict/iterable E and F. If E has a .keys() method, does: for k in E: D[k] = E[k] If E lacks .keys() method, does: for (k, v) in E: D[k] = v In either case, this is followed by: for k in F: D[k] = F[k]dict.fromkeys(S[,v]) -> New dict with keys from S and values equal to v. v defaults to None.D.clear() -> None. Remove all items from D.D.copy() -> a shallow copy of DD.iterkeys() -> an iterator over the keys of DD.itervalues() -> an iterator over the values of DD.iteritems() -> an iterator over the (key, value) items of DPrivate method returning an estimate of len(list(it)).z|@`ssE `h@@% Ps#SA`u,SA`uESA` u00uHiCHj@jj^jS0kC``k]Sl@plilslb0# m S@ n߰%n`!nz no oe`opo V(P('`'Ap%&v@v6P& & %module(name[, doc]) Create a module object. The name must be a string; the optional doc argument can have any type. @35Ev0 x0c_IxyZ:P:Z: :XzXz`z`zhzhzpzpzxzxzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz{{{{{{{{ { {({({0{0{8{8{@{@{H{H{P{P{xrange([start,] stop[, step]) -> xrange object Like range(), but instead of returning a list, returns an object that generates the numbers in the range on demand. For looping, this is slightly faster than range() and more memory efficient.Returns a reverse iterator.Private method returning an estimate of len(list(it)).``v~`{s~ta0trptdrS|rt|set() -> new empty set object set(iterable) -> new set object Build an unordered collection of unique elements.frozenset() -> empty frozenset object frozenset(iterable) -> frozenset object Build an immutable unordered collection of unique elements.Add an element to a set. This has no effect if the element is already present.Remove all elements from this set.x.__contains__(y) <==> y in x.Return a shallow copy of a set.Remove an element from a set if it is a member. If the element is not a member, do nothing.Return the difference of two or more sets as a new set. (i.e. all elements that are in this set but not the others.)Remove all elements of another set from this set.Return the intersection of two or more sets as a new set. (i.e. elements that are common to all of the sets.)Update a set with the intersection of itself and another.Return True if two sets have a null intersection.Report whether another set contains this set.Report whether this set contains another set.Remove and return an arbitrary set element. Raises KeyError if the set is empty.Return state information for pickling.Remove an element from a set; it must be a member. If the element is not a member, raise a KeyError.S.__sizeof__() -> size of S in memory, in bytesReturn the symmetric difference of two sets as a new set. (i.e. all elements that are in exactly one of the sets.)Update a set with the symmetric difference of itself and another.Return the union of sets as a new set. (i.e. all elements that are in either set.)Update a set with the union of itself and others.Private method returning an estimate of len(list(it)).&bd@Pp E Pypp``Ч6bd@Pp yEPypp``0@bpzA@zP P @px`Lb0@߰u@HĀ`0Pbp b@bXb@ebСyb |b@bC`0 #`b bbPb`P u@HĀ`Pb@Xb@yb |b@b0 b bP slice([start,] stop[, step]) Create a slice object. This is used for extended slicing (e.g. a[0:10:2]).S.indices(len) -> (start, stop, stride) Assuming a sequence of length len, calculate the start and stop indices, and the stride length of the extended slice described by S. Out of bounds indices are clipped in a manner consistent with the handling of normal slices.Return state information for pickling.{cijк0@ c`pL&c cType basestring cannot be instantiated; it is the base for str and unicode.str(object) -> string Return a nice string representation of the object. If the argument is a string, the return value is the same object.S.join(iterable) -> string Return a string which is the concatenation of the strings in the iterable. The separator between elements is S.S.split([sep [,maxsplit]]) -> list of strings Return a list of the words in the string S, using sep as the delimiter string. If maxsplit is given, at most maxsplit splits are done. If sep is not specified or is None, any whitespace string is a separator and empty strings are removed from the result.S.rsplit([sep [,maxsplit]]) -> list of strings Return a list of the words in the string S, using sep as the delimiter string, starting at the end of the string and working to the front. If maxsplit is given, at most maxsplit splits are done. If sep is not specified or is None, any whitespace string is a separator.S.lower() -> string Return a copy of the string S converted to lowercase.S.upper() -> string Return a copy of the string S converted to uppercase.S.islower() -> bool Return True if all cased characters in S are lowercase and there is at least one cased character in S, False otherwise.S.isupper() -> bool Return True if all cased characters in S are uppercase and there is at least one cased character in S, False otherwise.S.isspace() -> bool Return True if all characters in S are whitespace and there is at least one character in S, False otherwise.S.isdigit() -> bool Return True if all characters in S are digits and there is at least one character in S, False otherwise.S.istitle() -> bool Return True if S is a titlecased string and there is at least one character in S, i.e. uppercase characters may only follow uncased characters and lowercase characters only cased ones. Return False otherwise.S.isalpha() -> bool Return True if all characters in S are alphabetic and there is at least one character in S, False otherwise.S.isalnum() -> bool Return True if all characters in S are alphanumeric and there is at least one character in S, False otherwise.S.capitalize() -> string Return a copy of the string S with only its first character capitalized.S.count(sub[, start[, end]]) -> int Return the number of non-overlapping occurrences of substring sub in string S[start:end]. Optional arguments start and end are interpreted as in slice notation.S.endswith(suffix[, start[, end]]) -> bool Return True if S ends with the specified suffix, False otherwise. With optional start, test S beginning at that position. With optional end, stop comparing S at that position. suffix can also be a tuple of strings to try.S.partition(sep) -> (head, sep, tail) Search for the separator sep in S, and return the part before it, the separator itself, and the part after it. If the separator is not found, return S and two empty strings.S.find(sub [,start [,end]]) -> int Return the lowest index in S where substring sub is found, such that sub is contained within s[start:end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.S.index(sub [,start [,end]]) -> int Like S.find() but raise ValueError when the substring is not found.S.lstrip([chars]) -> string or unicode Return a copy of the string S with leading whitespace removed. If chars is given and not None, remove characters in chars instead. If chars is unicode, S will be converted to unicode before strippingS.replace(old, new[, count]) -> string Return a copy of string S with all occurrences of substring old replaced by new. If the optional argument count is given, only the first count occurrences are replaced.S.rfind(sub [,start [,end]]) -> int Return the highest index in S where substring sub is found, such that sub is contained within s[start:end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.S.rindex(sub [,start [,end]]) -> int Like S.rfind() but raise ValueError when the substring is not found.S.rstrip([chars]) -> string or unicode Return a copy of the string S with trailing whitespace removed. If chars is given and not None, remove characters in chars instead. If chars is unicode, S will be converted to unicode before strippingS.rpartition(sep) -> (head, sep, tail) Search for the separator sep in S, starting at the end of S, and return the part before it, the separator itself, and the part after it. If the separator is not found, return two empty strings and S.S.startswith(prefix[, start[, end]]) -> bool Return True if S starts with the specified prefix, False otherwise. With optional start, test S beginning at that position. With optional end, stop comparing S at that position. prefix can also be a tuple of strings to try.S.strip([chars]) -> string or unicode Return a copy of the string S with leading and trailing whitespace removed. If chars is given and not None, remove characters in chars instead. If chars is unicode, S will be converted to unicode before strippingS.swapcase() -> string Return a copy of the string S with uppercase characters converted to lowercase and vice versa.S.translate(table [,deletechars]) -> string Return a copy of the string S, where all characters occurring in the optional argument deletechars are removed, and the remaining characters have been mapped through the given translation table, which must be a string of length 256.S.title() -> string Return a titlecased version of S, i.e. words start with uppercase characters, all remaining cased characters have lowercase.S.ljust(width[, fillchar]) -> string Return S left-justified in a string of length width. Padding is done using the specified fill character (default is a space).S.rjust(width[, fillchar]) -> string Return S right-justified in a string of length width. Padding is done using the specified fill character (default is a space)S.center(width[, fillchar]) -> string Return S centered in a string of length width. Padding is done using the specified fill character (default is a space)S.zfill(width) -> string Pad a numeric string S with zeros on the left, to fill a field of the specified width. The string S is never truncated.S.format(*args, **kwargs) -> string S.__format__(format_spec) -> string S.encode([encoding[,errors]]) -> object Encodes S using the codec registered for encoding. encoding defaults to the default encoding. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a UnicodeEncodeError. Other possible values are 'ignore', 'replace' and 'xmlcharrefreplace' as well as any other name registered with codecs.register_error that is able to handle UnicodeEncodeErrors.S.decode([encoding[,errors]]) -> object Decodes S using the codec registered for encoding. encoding defaults to the default encoding. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a UnicodeDecodeError. Other possible values are 'ignore' and 'replace' as well as any other name registered with codecs.register_error that is able to handle UnicodeDecodeErrors.S.expandtabs([tabsize]) -> string Return a copy of S where all tab characters are expanded using spaces. If tabsize is not given, a tab size of 8 characters is assumed.S.splitlines([keepends]) -> list of strings Return a list of the lines in S, breaking at line boundaries. Line breaks are not included in the resulting list unless keepends is given and true.S.__sizeof__() -> size of S in memory, in bytese`A0$ȶԶ&e0@H^ePX^ԑip-`[ 0`=U;`SC`3@K+#`-h`o :`LP`.@Ehc@n@V@@`y@,`P(M@'t `p Pae"`9 e@ fp8x:fP@ n_sequence_fieldsn_fieldsn_unnamed_fieldsvrqz0j@on`l@jPn0jljsp H po``wtuple() -> empty tuple tuple(iterable) -> tuple initialized from iterable's items If the argument is a tuple, the return value is the same object.T.__sizeof__() -- size of T in memory, in bytesT.index(value, [start, [stop]]) -> integer -- return first index of value. Raises ValueError if the value is not present.T.count(value) -> integer -- return number of occurrences of valuePrivate method returning an estimate of len(list(it)). Pp@hpE`Pz@ps0{Azzq@z`p}@zЇ|L}@}| type(object) -> the object's type type(name, bases, dict) -> a new typesuper(type) -> unbound super object super(type, obj) -> bound super object; requires isinstance(obj, type) super(type, type2) -> bound super object; requires issubclass(type2, type) Typical use to call a cooperative superclass method: class C(B): def meth(self, arg): super(C, self).meth(arg)Abstract classes can override this to customize issubclass(). This is invoked early on by abc.ABCMeta.__subclasscheck__(). It should return True, False or NotImplemented. If it returns NotImplemented, the normal algorithm is used. Otherwise, it overrides the normal algorithm (and the outcome is cached). Y!@_dE0`PRИԑ `pE`0 lPp0.tӆ%tCx 0|` Hi`]`0`Tu09Q`Cd0ih`]h`P`G`i?6.%Ç ڇ  ``pPpй,/4'Hp\7 pt ܈00'p>pTk>p`T;  0ȉ\@x 0$0+(P0B,0Y00p4`080<0@p0Պ{D 0sH0LrL5fPRYPleT0XX00DP[:,׋[:(<@ T@p&1H 01 [: H [:  [: L0́ $[:( L0p( $[:&dB-dW4dm;d`Bd@Id alČ`p(F \)0ތ0pWV[: [:)p`ȂUU`Ȃc z ,@Rl`+8TBhT]lPdF06б)аЮtt9؃@СÍэ   ,pEPjj0 4` @APjj>` @APjjP0~~}|@|{{@{zPzy0yxxwPwv`vu@ut t@sr rqqppoPon0nmm0mllmkpkp%kunicode(string [, encoding[, errors]]) -> object Create a new Unicode object from the given encoded string. encoding defaults to the current default string encoding. errors can be 'strict', 'replace' or 'ignore' and defaults to 'strict'.S.encode([encoding[,errors]]) -> string or unicode Encodes S using the codec registered for encoding. encoding defaults to the default encoding. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a UnicodeEncodeError. Other possible values are 'ignore', 'replace' and 'xmlcharrefreplace' as well as any other name registered with codecs.register_error that can handle UnicodeEncodeErrors.S.replace(old, new[, count]) -> unicode Return a copy of S with all occurrences of substring old replaced by new. If the optional argument count is given, only the first count occurrences are replaced.S.split([sep [,maxsplit]]) -> list of strings Return a list of the words in S, using sep as the delimiter string. If maxsplit is given, at most maxsplit splits are done. If sep is not specified or is None, any whitespace string is a separator and empty strings are removed from the result.S.rsplit([sep [,maxsplit]]) -> list of strings Return a list of the words in S, using sep as the delimiter string, starting at the end of the string and working to the front. If maxsplit is given, at most maxsplit splits are done. If sep is not specified, any whitespace string is a separator.S.join(iterable) -> unicode Return a string which is the concatenation of the strings in the iterable. The separator between elements is S.S.capitalize() -> unicode Return a capitalized version of S, i.e. make the first character have upper case.S.title() -> unicode Return a titlecased version of S, i.e. words start with title case characters, all remaining cased characters have lower case.S.center(width[, fillchar]) -> unicode Return S centered in a Unicode string of length width. Padding is done using the specified fill character (default is a space)S.count(sub[, start[, end]]) -> int Return the number of non-overlapping occurrences of substring sub in Unicode string S[start:end]. Optional arguments start and end are interpreted as in slice notation.S.expandtabs([tabsize]) -> unicode Return a copy of S where all tab characters are expanded using spaces. If tabsize is not given, a tab size of 8 characters is assumed.S.find(sub [,start [,end]]) -> int Return the lowest index in S where substring sub is found, such that sub is contained within s[start:end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.S.partition(sep) -> (head, sep, tail) Search for the separator sep in S, and return the part before it, the separator itself, and the part after it. If the separator is not found, return S and two empty strings.S.index(sub [,start [,end]]) -> int Like S.find() but raise ValueError when the substring is not found.S.ljust(width[, fillchar]) -> int Return S left-justified in a Unicode string of length width. Padding is done using the specified fill character (default is a space).S.lower() -> unicode Return a copy of the string S converted to lowercase.S.lstrip([chars]) -> unicode Return a copy of the string S with leading whitespace removed. If chars is given and not None, remove characters in chars instead. If chars is a str, it will be converted to unicode before strippingS.decode([encoding[,errors]]) -> string or unicode Decodes S using the codec registered for encoding. encoding defaults to the default encoding. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a UnicodeDecodeError. Other possible values are 'ignore' and 'replace' as well as any other name registerd with codecs.register_error that is able to handle UnicodeDecodeErrors.S.rfind(sub [,start [,end]]) -> int Return the highest index in S where substring sub is found, such that sub is contained within s[start:end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.S.rindex(sub [,start [,end]]) -> int Like S.rfind() but raise ValueError when the substring is not found.S.rjust(width[, fillchar]) -> unicode Return S right-justified in a Unicode string of length width. Padding is done using the specified fill character (default is a space).S.rstrip([chars]) -> unicode Return a copy of the string S with trailing whitespace removed. If chars is given and not None, remove characters in chars instead. If chars is a str, it will be converted to unicode before strippingS.rpartition(sep) -> (head, sep, tail) Search for the separator sep in S, starting at the end of S, and return the part before it, the separator itself, and the part after it. If the separator is not found, return two empty strings and S.S.splitlines([keepends]) -> list of strings Return a list of the lines in S, breaking at line boundaries. Line breaks are not included in the resulting list unless keepends is given and true.S.strip([chars]) -> unicode Return a copy of the string S with leading and trailing whitespace removed. If chars is given and not None, remove characters in chars instead. If chars is a str, it will be converted to unicode before strippingS.swapcase() -> unicode Return a copy of S with uppercase characters converted to lowercase and vice versa.S.translate(table) -> unicode Return a copy of the string S, where all characters have been mapped through the given translation table, which must be a mapping of Unicode ordinals to Unicode ordinals, Unicode strings or None. Unmapped characters are left untouched. Characters mapped to None are deleted.S.upper() -> unicode Return a copy of S converted to uppercase.S.startswith(prefix[, start[, end]]) -> bool Return True if S starts with the specified prefix, False otherwise. With optional start, test S beginning at that position. With optional end, stop comparing S at that position. prefix can also be a tuple of strings to try.S.endswith(suffix[, start[, end]]) -> bool Return True if S ends with the specified suffix, False otherwise. With optional start, test S beginning at that position. With optional end, stop comparing S at that position. suffix can also be a tuple of strings to try.S.islower() -> bool Return True if all cased characters in S are lowercase and there is at least one cased character in S, False otherwise.S.isupper() -> bool Return True if all cased characters in S are uppercase and there is at least one cased character in S, False otherwise.S.istitle() -> bool Return True if S is a titlecased string and there is at least one character in S, i.e. upper- and titlecase characters may only follow uncased characters and lowercase characters only cased ones. Return False otherwise.S.isspace() -> bool Return True if all characters in S are whitespace and there is at least one character in S, False otherwise.S.isdecimal() -> bool Return True if there are only decimal characters in S, False otherwise.S.isdigit() -> bool Return True if all characters in S are digits and there is at least one character in S, False otherwise.S.isnumeric() -> bool Return True if there are only numeric characters in S, False otherwise.S.isalpha() -> bool Return True if all characters in S are alphabetic and there is at least one character in S, False otherwise.S.isalnum() -> bool Return True if all characters in S are alphanumeric and there is at least one character in S, False otherwise.S.zfill(width) -> unicode Pad a numeric string S with zeros on the left, to fill a field of the specified width. The string S is never truncated.S.format(*args, **kwargs) -> unicode S.__format__(format_spec) -> unicode S.__sizeof__() -> size of S in memory, in bytes -0@ ; (@pC epe` B4ZkZ4   < = P X R [pg M `0O f`:N  oW  LM =@.pJ x ? h M `cPL `t 0J nU b I y` U0@V@G hE ;SK C fж3p p+0#@ae9 ep f`0`_warnings provides basic warning filtering support. It is a helper module to speed up interpreter start-up.Issue a warning, or maybe ignore it or raise an exception.Low-level inferface to warnings functionality.  %%E ////%cI/c /DD~DsX/eZ~/eZ~/e/Y/!e/*Z~%WW/hIIVWD%~sB~~]I/Z~/eslplpDB IDDKDij=UcDX%Yc/I 'IBVDcP Built-in functions, exceptions, and other objects. Noteworthy: None is the `nil' object; Ellipsis represents `...' in slices.argument %d to map() must support iteration__import__(name, globals={}, locals={}, fromlist=[], level=-1) -> module Import a module. The globals are only used to determine the context; they are not modified. The locals are currently unused. The fromlist should be a list of names to emulate ``from name import ...'', or an empty list to emulate ``import name''. When importing a module from a package, note that __import__('A.B', ...) returns package A when fromlist is empty, but its submodule B when fromlist is not empty. Level is used to determine whether to perform absolute or relative imports. -1 is the original strategy of attempting both absolute and relative imports, 0 is absolute, a positive number is the number of parent directories to search relative to the current module.abs(number) -> number Return the absolute value of the argument.all(iterable) -> bool Return True if bool(x) is True for all values x in the iterable.any(iterable) -> bool Return True if bool(x) is True for any x in the iterable.apply(object[, args[, kwargs]]) -> value Call a callable object with positional arguments taken from the tuple args, and keyword arguments taken from the optional dictionary kwargs. Note that classes are callable, as are instances with a __call__() method. Deprecated since release 2.3. Instead, use the extended call syntax: function(*args, **keywords).bin(number) -> string Return the binary representation of an integer or long integer.callable(object) -> bool Return whether the object is callable (i.e., some kind of function). Note that classes are callable, as are instances with a __call__() method.chr(i) -> character Return a string of one character with ordinal i; 0 <= i < 256.cmp(x, y) -> integer Return negative if xy.coerce(x, y) -> (x1, y1) Return a tuple consisting of the two numeric arguments converted to a common type, using the same rules as used by arithmetic operations. If coercion is not possible, raise TypeError.compile(source, filename, mode[, flags[, dont_inherit]]) -> code object Compile the source string (a Python module, statement or expression) into a code object that can be executed by the exec statement or eval(). The filename will be used for run-time error messages. The mode must be 'exec' to compile a module, 'single' to compile a single (interactive) statement, or 'eval' to compile an expression. The flags argument, if present, controls which future statements influence the compilation of the code. The dont_inherit argument, if non-zero, stops the compilation inheriting the effects of any future statements in effect in the code calling compile; if absent or zero these statements do influence the compilation, in addition to any features explicitly specified.delattr(object, name) Delete a named attribute on an object; delattr(x, 'y') is equivalent to ``del x.y''.dir([object]) -> list of strings If called without an argument, return the names in the current scope. Else, return an alphabetized list of names comprising (some of) the attributes of the given object, and of attributes reachable from it. If the object supplies a method named __dir__, it will be used; otherwise the default dir() logic is used and returns: for a module object: the module's attributes. for a class object: its attributes, and recursively the attributes of its bases. for any other object: its attributes, its class's attributes, and recursively the attributes of its class's base classes.divmod(x, y) -> (div, mod) Return the tuple ((x-x%y)/y, x%y). Invariant: div*y + mod == x.eval(source[, globals[, locals]]) -> value Evaluate the source in the context of globals and locals. The source may be a string representing a Python expression or a code object as returned by compile(). The globals must be a dictionary and locals can be any mapping, defaulting to the current globals and locals. If only globals is given, locals defaults to it. execfile(filename[, globals[, locals]]) Read and execute a Python script from a file. The globals and locals are dictionaries, defaulting to the current globals and locals. If only globals is given, locals defaults to it.filter(function or None, sequence) -> list, tuple, or string Return those items of sequence for which function(item) is true. If function is None, return the items that are true. If sequence is a tuple or string, return the same type, else return a list.format(value[, format_spec]) -> string Returns value.__format__(format_spec) format_spec defaults to ""getattr(object, name[, default]) -> value Get a named attribute from an object; getattr(x, 'y') is equivalent to x.y. When a default argument is given, it is returned when the attribute doesn't exist; without it, an exception is raised in that case.globals() -> dictionary Return the dictionary containing the current scope's global variables.hasattr(object, name) -> bool Return whether the object has an attribute with the given name. (This is done by calling getattr(object, name) and catching exceptions.)hash(object) -> integer Return a hash value for the object. Two objects with the same value have the same hash value. The reverse is not necessarily true, but likely.hex(number) -> string Return the hexadecimal representation of an integer or long integer.id(object) -> integer Return the identity of an object. This is guaranteed to be unique among simultaneously existing objects. (Hint: it's the object's memory address.)input([prompt]) -> value Equivalent to eval(raw_input(prompt)).intern(string) -> string ``Intern'' the given string. This enters the string in the (global) table of interned strings whose purpose is to speed up dictionary lookups. Return the string itself or the previously interned string object with the same value.isinstance(object, class-or-type-or-tuple) -> bool Return whether an object is an instance of a class or of a subclass thereof. With a type as second argument, return whether that is the object's type. The form using a tuple, isinstance(x, (A, B, ...)), is a shortcut for isinstance(x, A) or isinstance(x, B) or ... (etc.).issubclass(C, B) -> bool Return whether class C is a subclass (i.e., a derived class) of class B. When using a tuple as the second argument issubclass(X, (A, B, ...)), is a shortcut for issubclass(X, A) or issubclass(X, B) or ... (etc.).iter(collection) -> iterator iter(callable, sentinel) -> iterator Get an iterator from an object. In the first form, the argument must supply its own iterator, or be a sequence. In the second form, the callable is called until it returns the sentinel.len(object) -> integer Return the number of items of a sequence or mapping.locals() -> dictionary Update and return a dictionary containing the current scope's local variables.map(function, sequence[, sequence, ...]) -> list Return a list of the results of applying the function to the items of the argument sequence(s). If more than one sequence is given, the function is called with an argument list consisting of the corresponding item of each sequence, substituting None for missing values when not all sequences have the same length. If the function is None, return a list of the items of the sequence (or a list of tuples if more than one sequence).max(iterable[, key=func]) -> value max(a, b, c, ...[, key=func]) -> value With a single iterable argument, return its largest item. With two or more arguments, return the largest argument.min(iterable[, key=func]) -> value min(a, b, c, ...[, key=func]) -> value With a single iterable argument, return its smallest item. With two or more arguments, return the smallest argument.next(iterator[, default]) Return the next item from the iterator. If default is given and the iterator is exhausted, it is returned instead of raising StopIteration.oct(number) -> string Return the octal representation of an integer or long integer.open(name[, mode[, buffering]]) -> file object Open a file using the file() type, returns a file object. This is the preferred way to open a file.ord(c) -> integer Return the integer ordinal of a one-character string.pow(x, y[, z]) -> number With two arguments, equivalent to x**y. With three arguments, equivalent to (x**y) % z, but may be more efficient (e.g. for longs).print(value, ..., sep=' ', end='\n', file=sys.stdout) Prints the values to a stream, or to sys.stdout by default. Optional keyword arguments: file: a file-like object (stream); defaults to the current sys.stdout. sep: string inserted between values, default a space. end: string appended after the last value, default a newline.range([start,] stop[, step]) -> list of integers Return a list containing an arithmetic progression of integers. range(i, j) returns [i, i+1, i+2, ..., j-1]; start (!) defaults to 0. When step is given, it specifies the increment (or decrement). For example, range(4) returns [0, 1, 2, 3]. The end point is omitted! These are exactly the valid indices for a list of 4 elements.raw_input([prompt]) -> string Read a string from standard input. The trailing newline is stripped. If the user hits EOF (Unix: Ctl-D, Windows: Ctl-Z+Return), raise EOFError. On Unix, GNU readline is used if enabled. The prompt string, if given, is printed without a trailing newline before reading.reduce(function, sequence[, initial]) -> value Apply a function of two arguments cumulatively to the items of a sequence, from left to right, so as to reduce the sequence to a single value. For example, reduce(lambda x, y: x+y, [1, 2, 3, 4, 5]) calculates ((((1+2)+3)+4)+5). If initial is present, it is placed before the items of the sequence in the calculation, and serves as a default when the sequence is empty.reload(module) -> module Reload the module. The module must have been successfully imported before.repr(object) -> string Return the canonical string representation of the object. For most object types, eval(repr(object)) == object.round(number[, ndigits]) -> floating point number Round a number to a given precision in decimal digits (default 0 digits). This always returns a floating point number. Precision may be negative.setattr(object, name, value) Set a named attribute on an object; setattr(x, 'y', v) is equivalent to ``x.y = v''.sorted(iterable, cmp=None, key=None, reverse=False) --> new sorted listsum(sequence[, start]) -> value Returns the sum of a sequence of numbers (NOT strings) plus the value of parameter 'start' (which defaults to 0). When the sequence is empty, returns start.unichr(i) -> Unicode character Return a Unicode string of one character with ordinal i; 0 <= i <= 0x10ffff.vars([object]) -> dictionary Without arguments, equivalent to locals(). With an argument, equivalent to object.__dict__.zip(seq1 [, seq2 [...]]) -> [(seq1[0], seq2[0] ...), (...)] Return a list of tuples, where each tuple contains the i-th element from each of the argument sequences. The returned list is truncated in length to the length of the shortest argument sequence.Me me  L  MK @ M d  Mc  pD  L@' @ +Z+  Mb fM` K$ _ XM@_   #>  %S;= %`* &M `'@# '  `(Lp9 (L4 `)S3 *M' @,K`& -M% @/?% /K$ `0K# @1K! 1K  2K 2 `3  3M+Z+e`MN N\&3n%%MNchIIVNdd3,kT md:k`S pmRk R mHkP (nakrk M ncs dGHdS(sHello world...N((((shello.pys?s9Mp@9hWp@9bp@9hCopyright (c) 2001-2010 Python Software Foundation. All Rights Reserved. Copyright (c) 2000 BeOpen.com. All Rights Reserved. Copyright (c) 1995-2001 Corporation for National Research Initiatives. All Rights Reserved. Copyright (c) 1991-1995 Stichting Mathematisch Centrum, Amsterdam. All Rights Reserved.          !"!#$%&'()*+ ,- - ./0123456789:;<=>?@ABCDEF -GHIJKLM M JJ NNP POOQMRSTUVWXYZ[\]^_^`=U ^ abc b^ c   c dePTfPghjjjklmjkn\k^opqrstqTuvwxyz{|Us}Us~; -  m MMMMTT  `=Ui\j`=Uk\j U@D@Ln|Q{|R|@R|R|`S|S|T(|T?| UV |Vm |`Vm }V |W |`W|W|@X} Xɀ}`Y}Y%}Z/}@Z%:}Z<H}ZST} [j_}`[ \j}`\v}\Ɓ}]݁}]݁}@^݁}^݁ }^݁!} _"}_ #}@`"$}`9%}aP&~ag'~ b~(~ c)!~d*+~`eÂ+4~eڂ,B~@f-H~f.V~@g/_~g0Z~h1k~h2s~h3|~ i4?i65~iM6 j67~`j68~j69~j6:~ k6;~`k6<~k6=~ld>~ `ld?~m@~nAc~nB~o{C~oD~ pEpF @q6GqHrI(rJ1@s׃KqtL9`tMCt~NL@uPOTuP]u~QevPRlvSv w݁T`wj $ G2 JIg~ , 0 $   !"#T%&'()*+,-./1L#cFp}}`M6%&'()iga0+Al*-.1/ @A2A3+45Ic78!9:";<0 =>B@ ? HRMPCDEKLNOQS`;l;p;t;;;;;;;;;;;;;;;;;;;;;;;;;;;< <<< <$<4<<<@<H<L<T<X<\<`<d<l<t<|<<<<< <<<<<<<< =0=4=8=D=L=P=X=`=d=l=t=x=|========================>>> >> >$>0>4>8><>@>H>L>P>T>\>`>d>h>p>x>|>>>>>>>>>>>>>>>>>>>??? ??? ?$?(?,?0?4?8? module Reload the module. The module must have been successfully imported before.find_module(name, [path]) -> (file, filename, (suffix, mode, type)) Search for a module. If path is omitted or None, search for a built-in, frozen or special module and continue search in sys.path. The module name cannot contain '.'; to search for a submodule of a package, pass the submodule name and the package's __path__.get_magic() -> string Return the magic number for .pyc or .pyo files.get_suffixes() -> [(suffix, mode, type), ...] Return a list of (suffix, mode, type) tuples describing the files that find_module() looks for.load_module(name, file, filename, (suffix, mode, type)) -> module Load a module, given information returned by find_module(). The module name must include the full package name, if any.new_module(name) -> module Create a new module. Do not enter it in sys.modules. The module name must include the full package name, if any.lock_held() -> boolean Return True if the import lock is currently held, else False. On platforms without threads, return False.acquire_lock() -> None Acquires the interpreter's import lock for the current thread. This lock should be used by import hooks to ensure thread-safety when importing modules. On platforms without threads, this function does nothing.release_lock() -> None Release the interpreter's import lock. On platforms without threads, this function does nothing.'8`p M @xIp xM  zW z7  {@ {d |n  }{  ~ 0 ׆0    0  0P i [:[: [:[:[:[:[:[:DDDvM+ȉG҉d݉IP This module contains functions that can read and write Python values in a binary format. The format is specific to Python, but independent of machine architecture issues. Not all Python object types are supported; in general, only objects whose value is independent from a particular invocation of Python can be written and read by this module. The following types are supported: None, integers, long integers, floating point numbers, strings, Unicode objects, tuples, lists, sets, dictionaries, and code objects, where it should be understood that tuples, lists and dictionaries are only supported as long as the values contained therein are themselves supported; and recursive lists and dictionaries should not be written (they will cause infinite loops). Variables: version -- indicates the format that the module uses. Version 0 is the historical format, version 1 (added in Python 2.4) shares interned strings and version 2 (added in Python 2.5) uses a binary format for floating point numbers. (New in version 2.4) Functions: dump() -- write value to a file load() -- read value from a file dumps() -- write value to a string loads() -- read value from a stringdump(value, file[, version]) Write the value on the open file. The value must be a supported type. The file must be an open file object such as sys.stdout or returned by open() or os.popen(). It must be opened in binary mode ('wb' or 'w+b'). If the value has (or contains an object that has) an unsupported type, a ValueError exception is raised — but garbage data will also be written to the file. The object will not be properly read back by load() New in version 2.4: The version argument indicates the data format that dump should use.load(file) Read one value from the open file and return it. If no valid value is read (e.g. because the data has a different Python version’s incompatible marshal format), raise EOFError, ValueError or TypeError. The file must be an open file object opened in binary mode ('rb' or 'r+b'). Note: If an object containing an unsupported type was marshalled with dump(), load() will substitute None for the unmarshallable type.dumps(value[, version]) Return the string that would be written to a file by dump(value, file). The value must be a supported type. Raise a ValueError exception if value has (or contains an object that has) an unsupported type. New in version 2.4: The version argument indicates the data format that dumps should use.loads(string) Convert the string to a value. If no valid value is found, raise EOFError, ValueError or TypeError. Extra characters in the string are ignored.6 @M! ߑ8 @` Python C API version mismatch for module %.100s: This Python has API version %d, module %.100s has version %d.ko<` и c~ < $Y%,This module provides access to some objects used or maintained by the interpreter and to functions that interact strongly with the interpreter. Dynamic objects: argv -- command line arguments; argv[0] is the script pathname if known path -- module search path; path[0] is the script directory, else '' modules -- dictionary of loaded modules displayhook -- called to show results in an interactive session excepthook -- called to handle any uncaught exception other than SystemExit To customize printing in an interactive session or to install a custom top-level exception handler, assign other functions to replace these. exitfunc -- if sys.exitfunc exists, this routine is called when Python exits Assigning to sys.exitfunc is deprecated; use the atexit module instead. stdin -- standard input file object; used by raw_input() and input() stdout -- standard output file object; used by the print statement stderr -- standard error object; used for error messages By assigning other file objects (or objects that behave like files) to these, it is possible to redirect all of the interpreter's I/O. last_type -- type of last uncaught exception last_value -- value of last uncaught exception last_traceback -- traceback of last uncaught exception These three are only available in an interactive session after a traceback has been printed. exc_type -- type of exception currently being handled exc_value -- value of exception currently being handled exc_traceback -- traceback of exception currently being handled The function exc_info() should be used instead of these three, because it is thread-safe. Static objects: maxint -- the largest supported integer (the smallest is -maxint-1) maxsize -- the largest supported length of containers. maxunicode -- the largest supported character builtin_module_names -- tuple of module names built into this interpreter version -- the version of this interpreter as a string version_info -- version information as a tuple hexversion -- version information encoded as a single integer copyright -- copyright notice pertaining to this interpreter platform -- platform identifier executable -- pathname of this Python interpreter prefix -- prefix used to find the Python library exec_prefix -- prefix used to find the machine-specific Python library __stdin__ -- the original stdin; don't touch! __stdout__ -- the original stdout; don't touch! __stderr__ -- the original stderr; don't touch! __displayhook__ -- the original displayhook; don't touch! __excepthook__ -- the original excepthook; don't touch! Functions: displayhook() -- print an object to the screen, and save it in __builtin__._ excepthook() -- print an exception and its traceback to sys.stderr exc_info() -- return thread-safe information about the current exception exc_clear() -- clear the exception state for the current thread exit() -- exit the interpreter by raising SystemExit getdlopenflags() -- returns flags to be used for dlopen() calls getprofile() -- get the global profiling function getrefcount() -- return the reference count for an object (plus one :-) getrecursionlimit() -- return the max recursion depth for the interpreter getsizeof() -- return the size of an object in bytes gettrace() -- get the global debug tracing function setcheckinterval() -- control how often the interpreter checks for events setdlopenflags() -- set the flags to be used for dlopen() calls setprofile() -- set the global profiling function setrecursionlimit() -- set the max recursion depth for the interpreter settrace() -- set the global debug tracing function callstats() -> tuple of integers Return a tuple of function call statistics, if CALL_PROFILE was defined when Python was built. Otherwise, return None. When enabled, this function returns detailed, implementation-specific details about the number of function calls executed. The return value is a 11-tuple where the entries in the tuple are counts of: 0. all function calls 1. calls to PyFunction_Type objects 2. PyFunction calls that do not create an argument tuple 3. PyFunction calls that do not create an argument tuple and bypass PyEval_EvalCodeEx() 4. PyMethod calls 5. PyMethod calls on bound methods 6. PyType calls 7. PyCFunction calls 8. generator calls 9. All other calls 10. Number of stack pops performed by call_function()_clear_type_cache() -> None Clear the internal type lookup cache._current_frames() -> dictionary Return a dictionary mapping each current thread T's thread id to T's current stack frame. This function should be used for specialized purposes only.displayhook(object) -> None Print an object to sys.stdout and also save it in __builtin__. exc_info() -> (type, value, traceback) Return information about the most recent exception caught by an except clause in the current stack frame or in an older stack frame.exc_clear() -> None Clear global information on the current exception. Subsequent calls to exc_info() will return (None,None,None) until another exception is raised in the current thread or the execution stack returns to a frame where another exception is being handled.excepthook(exctype, value, traceback) -> None Handle an exception by displaying it with a traceback on sys.stderr. exit([status]) Exit the interpreter by raising SystemExit(status). If the status is omitted or None, it defaults to zero (i.e., success). If the status is numeric, it will be used as the system exit status. If it is another kind of object, it will be printed and the system exit status will be one (i.e., failure).getdefaultencoding() -> string Return the current default string encoding used by the Unicode implementation.getdlopenflags() -> int Return the current value of the flags that are used for dlopen() calls. The flag constants are defined in the dl module.getfilesystemencoding() -> string Return the encoding used to convert Unicode filenames in operating system filenames.getrefcount(object) -> integer Return the reference count of object. The count returned is generally one higher than you might expect, because it includes the (temporary) reference as an argument to getrefcount().getrecursionlimit() Return the current value of the recursion limit, the maximum depth of the Python interpreter stack. This limit prevents infinite recursion from causing an overflow of the C stack and crashing Python.getsizeof(object, default) -> int Return the size of object in bytes._getframe([depth]) -> frameobject Return a frame object from the call stack. If optional integer depth is given, return the frame object that many calls below the top of the stack. If that is deeper than the call stack, ValueError is raised. The default for depth is zero, returning the frame at the top of the call stack. This function should be used for internal and specialized purposes only.setdefaultencoding(encoding) Set the current default string encoding used by the Unicode implementation.setcheckinterval(n) Tell the Python interpreter to check for asynchronous events every n instructions. This also affects how often thread switches occur.getcheckinterval() -> current check interval; see setcheckinterval().setdlopenflags(n) -> None Set the flags that will be used for dlopen() calls. Among other things, this will enable a lazy resolving of symbols when importing a module, if called as sys.setdlopenflags(0) To share symbols across extension modules, call as sys.setdlopenflags(dl.RTLD_NOW|dl.RTLD_GLOBAL)setprofile(function) Set the profiling function. It will be called on each function call and return. See the profiler chapter in the library manual.getprofile() Return the profiling function set with sys.setprofile. See the profiler chapter in the library manual.setrecursionlimit(n) Set the maximum depth of the Python interpreter stack to n. This limit prevents infinite recursion from causing an overflow of the C stack and crashing Python. The highest possible limit is platform- dependent.settrace(function) Set the global debug tracing function. It will be called on each function call. See the debugger chapter in the library manual.gettrace() Return the global debug tracing function set with sys.settrace. See the debugger chapter in the library manual.call_tracing(func, args) -> object Call func(*args), while tracing is enabled. The tracing state is saved, and restored afterwards. This is intended to be called from a debugger from a checkpoint, to recursively debug some other code.sys.flags Flags provided through command line arguments or environment vars.[:t`ԑSαԱܱܱ߱/2;EM-PSadw ° @"V@ Ұ `۰    @nP     P ) Ѯ `|@  `W ; F Lp  W  @b @k l@ `DA@]e nw[:g%mqv݈~d 6lib/python2.6/:This module provides access to the garbage collector for reference cycles. enable() -- Enable automatic garbage collection. disable() -- Disable automatic garbage collection. isenabled() -- Returns true if automatic collection is enabled. collect() -- Do a full collection right now. get_count() -- Return the current collection counts. set_debug() -- Set debugging flags. get_debug() -- Get debugging flags. set_threshold() -- Set the collection thresholds. get_threshold() -- Return the current the collection thresholds. get_objects() -- Return a list of all objects tracked by the collector. get_referrers() -- Return the list of objects that refer to an object. get_referents() -- Return the list of objects that an object refers to. enable() -> None Enable automatic garbage collection. disable() -> None Disable automatic garbage collection. isenabled() -> status Returns true if automatic garbage collection is enabled. set_debug(flags) -> None Set the garbage collection debugging flags. Debugging information is written to sys.stderr. flags is an integer and can have the following bits turned on: DEBUG_STATS - Print statistics during collection. DEBUG_COLLECTABLE - Print collectable objects found. DEBUG_UNCOLLECTABLE - Print unreachable but uncollectable objects found. DEBUG_INSTANCES - Print instance objects. DEBUG_OBJECTS - Print objects other than instances. DEBUG_SAVEALL - Save objects to gc.garbage rather than freeing them. DEBUG_LEAK - Debug leaking programs (everything but STATS). get_debug() -> flags Get the garbage collection debugging flags. get_count() -> (count0, count1, count2) Return the current collection counts set_threshold(threshold0, [threshold1, threshold2]) -> None Sets the collection thresholds. Setting threshold0 to zero disables collection. get_threshold() -> (threshold0, threshold1, threshold2) Return the current collection thresholds collect([generation]) -> n With no arguments, run a full collection. The optional argument may be an integer specifying which generation to collect. A ValueError is raised if the generation number is invalid. The number of unreachable objects is returned. get_objects() -> [...] Return a list of objects tracked by the collector (excluding the list returned). get_referrers(*objs) -> list Return the list of objects that directly refer to any of objs.get_referents(*objs) -> list Return the list of objects that are directly referred to by objs. (( Pk`kP@``r q  pThis module provides primitive operations to write multi-threaded programs. The 'threading' module provides a more convenient interface.A lock object is a synchronization primitive. To create a lock, call the PyThread_allocate_lock() function. Methods are: acquire() -- lock the lock, possibly blocking until it can be obtained release() -- unlock of the lock locked() -- test whether the lock is currently locked A lock is not owned by the thread that locked it; another thread may unlock it. A thread attempting to lock a lock that it has already locked will block until another thread unlocks it. Deadlocks may ensue.start_new_thread(function, args[, kwargs]) (start_new() is an obsolete synonym) Start a new thread and return its identifier. The thread will call the function with positional arguments from the tuple args and keyword arguments taken from the optional dictionary kwargs. The thread exits when the function returns; the return value is ignored. The thread will also exit when the function raises an unhandled exception; a stack trace will be printed unless the exception is SystemExit. allocate_lock() -> lock object (allocate() is an obsolete synonym) Create a new lock object. See LockType.__doc__ for information about locks.exit() (PyThread_exit_thread() is an obsolete synonym) This is synonymous to ``raise SystemExit''. It will cause the current thread to exit silently unless the exception is caught.interrupt_main() Raise a KeyboardInterrupt in the main thread. A subthread can use this function to interrupt the main thread.get_ident() -> integer Return a non-zero integer that uniquely identifies the current thread amongst other threads that exist simultaneously. This may be used to identify per-thread resources. Even though on some platforms threads identities may appear to be allocated consecutive numbers starting at 1, this behavior should not be relied upon, and the number should be seen purely as a magic cookie. A thread's identity may be reused for another thread after it exits.stack_size([size]) -> size Return the thread stack size used when creating new threads. The optional size argument specifies the stack size (in bytes) to be used for subsequently created threads, and must be 0 (use platform or configured default) or a positive integer value of at least 32,768 (32k). If changing the thread stack size is unsupported, a ThreadError exception is raised. If the specified size is invalid, a ValueError exception is raised, and the stack size is unmodified. 32k bytes currently the minimum supported stack size value to guarantee sufficient stack space for the interpreter itself. Note that some platforms may have particular restrictions on values for the stack size, such as requiring a minimum stack size larger than 32kB or requiring allocation in multiples of the system memory page size - platform documentation should be referred to for more information (4kB pages are common; using multiples of 4096 for the stack size is the suggested approach in the absence of more specific information).acquire([wait]) -> None or bool (acquire_lock() is an obsolete synonym) Lock the lock. Without argument, this blocks if the lock is already locked (even by the same thread), waiting for another thread to release the lock, and return None once the lock is acquired. With an argument, this will only block if the argument is true, and the return value reflects whether the lock is acquired. The blocking operation is not interruptible.release() (release_lock() is an obsolete synonym) Release the lock, allowing another thread that is blocked waiting for the lock to acquire the lock. The lock must be in the locked state, but it needn't be locked by the same thread that unlocks it.locked() -> bool (locked_lock() is an obsolete synonym) Return whether the lock is in the locked state.)7ISajP`nP`v  Іmnb{ ` ``` 4*4 ` This module provides mechanisms to use signal handlers in Python. Functions: alarm() -- cause SIGALRM after a specified time [Unix only] setitimer() -- cause a signal (described below) after a specified float time and the timer may restart then [Unix only] getitimer() -- get current value of timer [Unix only] signal() -- set the action for a given signal getsignal() -- get the signal action for a given signal pause() -- wait until a signal arrives [Unix only] default_int_handler() -- default SIGINT handler signal constants: SIG_DFL -- used to refer to the system default handler SIG_IGN -- used to ignore the signal NSIG -- number of defined signals SIGINT, SIGTERM, etc. -- signal numbers itimer constants: ITIMER_REAL -- decrements in real time, and delivers SIGALRM upon expiration ITIMER_VIRTUAL -- decrements only when the process is executing, and delivers SIGVTALRM upon expiration ITIMER_PROF -- decrements both when the process is executing and when the system is executing on behalf of the process. Coupled with ITIMER_VIRTUAL, this timer is usually used to profile the time spent by the application in user and kernel space. SIGPROF is delivered upon expiration. *** IMPORTANT NOTICE *** A signal handler function is called with two arguments: the first is the signal number, the second is the interrupted stack frame.alarm(seconds) Arrange for SIGALRM to arrive after the given number of seconds.setitimer(which, seconds[, interval]) Sets given itimer (one of ITIMER_REAL, ITIMER_VIRTUAL or ITIMER_PROF) to fire after value seconds and after that every interval seconds. The itimer can be cleared by setting seconds to zero. Returns old values as a tuple: (delay, interval).getitimer(which) Returns current value of given itimer.signal(sig, action) -> action Set the action for the given signal. The action can be SIG_DFL, SIG_IGN, or a callable Python object. The previous action is returned. See getsignal() for possible return values. *** IMPORTANT NOTICE *** A signal handler function is called with two arguments: the first is the signal number, the second is the interrupted stack frame.getsignal(sig) -> action Return the current action for the given signal. The return value can be: SIG_IGN -- if the signal is being ignored SIG_DFL -- if the default action for the signal is in effect None -- if an unknown handler is in effect anything else -- the callable Python object used as a handlerset_wakeup_fd(fd) -> fd Sets the fd to be written to (with '\0') when a signal comes in. A library can use this to wakeup select or poll. The previous fd is returned. The fd must be non-blocking.siginterrupt(sig, flag) -> None change system call restart behaviour: if flag is False, system calls will be restarted when interrupted by signal sig, else system calls will be interrupted.pause() Wait until a signal arrives.default_int_handler(...) The default handler for SIGINT installed by Python. It raises KeyboardInterrupt.P@``p4` k`\@@This module provides access to operating system functionality that is standardized by the C Standard and the POSIX standard (a thinly disguised Unix interface). Refer to the library manual and corresponding Unix manual entries for more information on calls.access(path, mode) -> True if granted, False otherwise Use the real uid/gid to test for access to a path. Note that most operations will use the effective uid/gid, therefore this routine can be used in a suid/sgid environment to test if the invoking user has the specified access to the path. The mode argument can be F_OK to test existence, or the inclusive-OR of R_OK, W_OK, and X_OK.ttyname(fd) -> string Return the name of the terminal device connected to 'fd'.chdir(path) Change the current working directory to the specified path.chmod(path, mode) Change the access permissions of a file.fchmod(fd, mode) Change the access permissions of the file given by file descriptor fd.chown(path, uid, gid) Change the owner and group id of path to the numeric uid and gid.fchown(fd, uid, gid) Change the owner and group id of the file given by file descriptor fd to the numeric uid and gid.lchown(path, uid, gid) Change the owner and group id of path to the numeric uid and gid. This function will not follow symbolic links.chroot(path) Change root directory to path.ctermid() -> string Return the name of the controlling terminal for this process.getcwd() -> path Return a string representing the current working directory.getcwdu() -> path Return a unicode string representing the current working directory.link(src, dst) Create a hard link to a file.listdir(path) -> list_of_strings Return a list containing the names of the entries in the directory. path: path of directory to list The list is in arbitrary order. It does not include the special entries '.' and '..' even if they are present in the directory.lstat(path) -> stat result Like stat(path), but do not follow symbolic links.mkdir(path [, mode=0777]) Create a directory.nice(inc) -> new_priority Decrease the priority of process by inc and return the new priority.readlink(path) -> path Return a string representing the path to which the symbolic link points.rename(old, new) Rename a file or directory.rmdir(path) Remove a directory.stat(path) -> stat result Perform a stat system call on the given path.stat_float_times([newval]) -> oldval Determine whether os.[lf]stat represents time stamps as float objects. If newval is True, future calls to stat() return floats, if it is False, future calls return ints. If newval is omitted, return the current setting. symlink(src, dst) Create a symbolic link pointing to src named dst.system(command) -> exit_status Execute the command (a string) in a subshell.umask(new_mask) -> old_mask Set the current numeric umask and return the previous umask.uname() -> (sysname, nodename, release, version, machine) Return a tuple identifying the current operating system.unlink(path) Remove a file (same as remove(path)).remove(path) Remove a file (same as unlink(path)).utime(path, (atime, mtime)) utime(path, None) Set the access and modified time of the file to the given values. If the second form is used, set the access and modified times to the current time.times() -> (utime, stime, cutime, cstime, elapsed_time) Return a tuple of floating point numbers indicating process times._exit(status) Exit to the system with specified status, without normal exit processing.execv(path, args) Execute an executable path with arguments, replacing current process. path: path of executable file args: tuple or list of stringsexecve(path, args, env) Execute a path with arguments and environment, replacing current process. path: path of executable file args: tuple or list of arguments env: dictionary of strings mapping to stringsfork() -> pid Fork a child process. Return 0 to child process and PID of child to parent process.openpty() -> (master_fd, slave_fd) Open a pseudo-terminal, returning open fd's for both master and slave end. forkpty() -> (pid, master_fd) Fork a new process with a new pseudo-terminal as controlling tty. Like fork(), return 0 as pid to child process, and PID of child to parent. To both, return fd of newly opened pseudo-terminal. getegid() -> egid Return the current process's effective group id.geteuid() -> euid Return the current process's effective user id.getgid() -> gid Return the current process's group id.getgroups() -> list of group IDs Return list of supplemental group IDs for the process.getpid() -> pid Return the current process idgetpgrp() -> pgrp Return the current process group id.getppid() -> ppid Return the parent's process id.getuid() -> uid Return the current process's user id.getlogin() -> string Return the actual login name.kill(pid, sig) Kill a process with a signal.killpg(pgid, sig) Kill a process group with a signal.popen(command [, mode='r' [, bufsize]]) -> pipe Open a pipe to/from a command returning a file object.setuid(uid) Set the current process's user id.seteuid(uid) Set the current process's effective user id.setegid(gid) Set the current process's effective group id.setreuid(ruid, euid) Set the current process's real and effective user ids.setregid(rgid, egid) Set the current process's real and effective group ids.setgid(gid) Set the current process's group id.setgroups(list) Set the groups of the current process to list.getpgid(pid) -> pgid Call the system call getpgid().setpgrp() Make this process the process group leader.wait() -> (pid, status) Wait for completion of a child process.wait3(options) -> (pid, status, rusage) Wait for completion of a child process.wait4(pid, options) -> (pid, status, rusage) Wait for completion of a given child process.waitpid(pid, options) -> (pid, status) Wait for completion of a given child process.getsid(pid) -> sid Call the system call getsid().setsid() Call the system call setsid().setpgid(pid, pgrp) Call the system call setpgid().tcgetpgrp(fd) -> pgid Return the process group associated with the terminal given by a fd.tcsetpgrp(fd, pgid) Set the process group associated with the terminal given by a fd.open(filename, flag [, mode=0777]) -> fd Open a file (for low level IO).close(fd) Close a file descriptor (for low level IO).closerange(fd_low, fd_high) Closes all file descriptors in [fd_low, fd_high), ignoring errors.dup(fd) -> fd2 Return a duplicate of a file descriptor.dup2(old_fd, new_fd) Duplicate file descriptor.lseek(fd, pos, how) -> newpos Set the current position of a file descriptor.read(fd, buffersize) -> string Read a file descriptor.write(fd, string) -> byteswritten Write a string to a file descriptor.fstat(fd) -> stat result Like stat(), but for an open file descriptor.fdopen(fd [, mode='r' [, bufsize]]) -> file_object Return an open file object connected to a file descriptor.isatty(fd) -> bool Return True if the file descriptor 'fd' is an open file descriptor connected to the slave end of a terminal.pipe() -> (read_end, write_end) Create a pipe.mkfifo(filename [, mode=0666]) Create a FIFO (a POSIX named pipe).mknod(filename [, mode=0600, device]) Create a filesystem node (file, device special file or named pipe) named filename. mode specifies both the permissions to use and the type of node to be created, being combined (bitwise OR) with one of S_IFREG, S_IFCHR, S_IFBLK, and S_IFIFO. For S_IFCHR and S_IFBLK, device defines the newly created device special file (probably using os.makedev()), otherwise it is ignored.major(device) -> major number Extracts a device major number from a raw device number.minor(device) -> minor number Extracts a device minor number from a raw device number.makedev(major, minor) -> device number Composes a raw device number from the major and minor device numbers.ftruncate(fd, length) Truncate a file to a specified length.putenv(key, value) Change or add an environment variable.unsetenv(key) Delete an environment variable.strerror(code) -> string Translate an error code to a message string.fchdir(fildes) Change to the directory of the given file descriptor. fildes must be opened on a directory, not a file.fsync(fildes) force write of file with filedescriptor to disk.fdatasync(fildes) force write of file with filedescriptor to disk. does not force update of metadata.WCOREDUMP(status) -> bool Return True if the process returning 'status' was dumped to a core file.WIFCONTINUED(status) -> bool Return True if the process returning 'status' was continued from a job control stop.WIFSTOPPED(status) -> bool Return True if the process returning 'status' was stopped.WIFSIGNALED(status) -> bool Return True if the process returning 'status' was terminated by a signal.WIFEXITED(status) -> bool Return true if the process returning 'status' exited using the exit() system call.WEXITSTATUS(status) -> integer Return the process return code from 'status'.WTERMSIG(status) -> integer Return the signal that terminated the process that provided the 'status' value.WSTOPSIG(status) -> integer Return the signal that stopped the process that provided the 'status' value.fstatvfs(fd) -> statvfs result Perform an fstatvfs system call on the given fd.statvfs(path) -> statvfs result Perform a statvfs system call on the given path.tmpfile() -> file object Create a temporary file with no directory entries.tempnam([dir[, prefix]]) -> string Return a unique name for a temporary file. The directory and a prefix may be specified as strings; they may be omitted or None if not needed.tmpnam() -> string Return a unique name for a temporary file.confstr(name) -> string Return a string-valued system configuration variable.sysconf(name) -> integer Return an integer-valued system configuration variable.fpathconf(fd, name) -> integer Return the configuration limit name for the file descriptor fd. If there is no limit, return -1.pathconf(path, name) -> integer Return the configuration limit name for the file or directory path. If there is no limit, return -1.abort() -> does not return! Abort the interpreter immediately. This 'dumps core' or otherwise fails in the hardest way possible on the hosting operating system.getloadavg() -> (float, float, float) Return the number of processes in the system run queue averaged over the last 1, 5, and 15 minutes or raises OSError if the load average was unobtainableurandom(n) -> str Return n random bytes suitable for cryptographic use.stat_result: Result from stat or lstat. This object may be accessed either as a tuple of (mode, ino, dev, nlink, uid, gid, size, atime, mtime, ctime) or via the attributes st_mode, st_ino, st_dev, st_nlink, st_uid, and so on. Posix/windows: If your platform supports st_blksize, st_blocks, st_rdev, or st_flags, they are available as attributes only. See os.stat for more information.statvfs_result: Result from statvfs or fstatvfs. This object may be accessed either as a tuple of (bsize, frsize, blocks, bfree, bavail, files, ffree, favail, flag, namemax), or via the attributes f_bsize, f_frsize, f_blocks, f_bfree, and so on. See os.statvfs for more information.0  @` ph`6o`@w~d `@tp `X@-`l0bй K@ ``0#0 }`m@me ZW @`@P K@A5)`@```@  `@ 0`P  ` @@0%@   p`@Ь``@`л%P ` Up) ; -P ! z o` d  0`  ` 6  >@б0@pE@K@ 0" B " V bv     _/(03`B1P2^4m3ya. WV$ %&+'<-Re^fjgv()*EF hi<*9+EGWjcslwx yz%{2|@STThmq}XU58>=9@?A,7:6E:M _ v ,op; !q+r7"GnTbuCMNIJOPQR*DCKWLm w#HBst<uvk}~0CX\g]y^[YZbcd 0AObpLMNOP.QKRSeTUVWXYZ ["*:AGNU^sz, %.9V`{This module makes available standard errno system symbols. The value of each symbol is the corresponding integer value, e.g., on most systems, errno.ENOENT equals the integer 2. The dictionary errno.errorcode maps numeric codes to symbol names, e.g., errno.errorcode[2] could be the string 'ENOENT'. Symbols that are not relevant to the underlying system are not defined. To map error codes to error messages, use the function os.strerror(), e.g. os.strerror(2) could return 'No such file or directory'.This module provides access to the Unix password database. It is available on all Unix versions. Password database entries are reported as 7-tuples containing the following items from the password database (see `'), in order: pw_name, pw_passwd, pw_uid, pw_gid, pw_gecos, pw_dir, pw_shell. The uid and gid items are integers, all others are strings. An exception is raised if the entry asked for cannot be found.getpwuid(uid) -> (pw_name,pw_passwd,pw_uid, pw_gid,pw_gecos,pw_dir,pw_shell) Return the password database entry for the given numeric user ID. See pwd.__doc__ for more on password database entries.getpwnam(name) -> (pw_name,pw_passwd,pw_uid, pw_gid,pw_gecos,pw_dir,pw_shell) Return the password database entry for the given user name. See pwd.__doc__ for more on password database entries.getpwall() -> list_of_entries Return a list of all available password database entries, in arbitrary order. See pwd.__doc__ for more on password database entries.pwd.struct_passwd: Results from getpw*() routines. This object may be accessed either as a tuple of (pw_name,pw_passwd,pw_uid,pw_gid,pw_gecos,pw_dir,pw_shell) or via the object attributes as named in the above tuple.q&e@'z`(@)*  SRE 2.2.2 Copyright (c) 1997-2002 by Secret Labs AB Compiled regular expression objectsmatch(string[, pos[, endpos]]) --> match object or None. Matches zero or more characters at the beginning of the stringsearch(string[, pos[, endpos]]) --> match object or None. Scan through string looking for a match, and return a corresponding MatchObject instance. Return None if no position in the string matches.sub(repl, string[, count = 0]) --> newstring Return the string obtained by replacing the leftmost non-overlapping occurrences of pattern in string by the replacement repl.subn(repl, string[, count = 0]) --> (newstring, number of subs) Return the tuple (new_string, number_of_subs_made) found by replacing the leftmost non-overlapping occurrences of pattern with the replacement repl.split(string[, maxsplit = 0]) --> list. Split string by the occurrences of pattern.findall(string[, pos[, endpos]]) --> list. Return a list of all non-overlapping matches of pattern in string.finditer(string[, pos[, endpos]]) --> iterator. Return an iterator over all non-overlapping matches for the RE pattern in string. For each match, the iterator returns a match object.Hh9)Y,09h, (@+ fM&y0$$P~@+z+D,:`-@w`.t.-@/,%%n# nG# G# `L&\&P`/(`& &SS`{register(search_function) Register a codec search function. Search functions are expected to take one argument, the encoding name in all lower case letters, and return a tuple of functions (encoder, decoder, stream_reader, stream_writer) (or a CodecInfo object).lookup(encoding) -> CodecInfo Looks up a codec tuple in the Python codec registry and returns a CodecInfo object.encode(obj, [encoding[,errors]]) -> object Encodes obj using the codec registered for encoding. encoding defaults to the default encoding. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a ValueError. Other possible values are 'ignore', 'replace' and 'xmlcharrefreplace' as well as any other name registered with codecs.register_error that can handle ValueErrors.decode(obj, [encoding[,errors]]) -> object Decodes obj using the codec registered for encoding. encoding defaults to the default encoding. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a ValueError. Other possible values are 'ignore' and 'replace' as well as any other name registered with codecs.register_error that is able to handle ValueErrors.register_error(errors, handler) Register the specified error handler under the name errors. handler must be a callable object, that will be called with an exception instance containing information about the location of the encoding/decoding error and must return a (replacement, new position) tuple.lookup_error(errors) -> handler Return the error handler for the specified error handling name or raise a LookupError, if no handler exists under this name. 5P@66x08epSA00 PЦPvaТK6P$ П`Мk@M:P' Г@:v;/__init__.pyc/__init__.pyo/__init__.py.pyc.pyo.pyzipimport provides support for importing Python modules from Zip archives. This module exports three objects: - zipimporter: a class; its constructor takes a path to a Zip archive. - ZipImportError: exception raised by zipimporter objects. It's a subclass of ImportError, so it can be caught as ImportError, too. - _zip_directory_cache: a dict, mapping archive paths to zip directory info dicts, as used in zipimporter._files. It is usually not needed to use the zipimport module explicitly; it is used by the builtin import mechanism for sys.path items that are paths to Zip archives.zipimporter(archivepath) -> zipimporter object Create a new zipimporter instance. 'archivepath' must be a path to a zipfile, or to a specific path inside a zipfile. For example, it can be '/tmp/myimport.zip', or '/tmp/myimport.zip/mydirectory', if mydirectory is a valid directory inside the archive. 'ZipImportError is raised if 'archivepath' doesn't point to a valid Zip archive. The 'archive' attribute of zipimporter objects contains the name of the zipfile targeted.find_module(fullname, path=None) -> self or None. Search for a module specified by 'fullname'. 'fullname' must be the fully qualified (dotted) module name. It returns the zipimporter instance itself if the module was found, or None if it wasn't. The optional 'path' argument is ignored -- it's there for compatibility with the importer protocol.load_module(fullname) -> module. Load the module specified by 'fullname'. 'fullname' must be the fully qualified (dotted) module name. It returns the imported module, or raises ZipImportError if it wasn't found.get_data(pathname) -> string with file data. Return the data associated with 'pathname'. Raise IOError if the file wasn't found.get_code(fullname) -> code object. Return the code object for the specified module. Raise ZipImportError if the module couldn't be found.get_source(fullname) -> source string. Return the source code for the specified module. Raise ZipImportError if the module couldn't be found, return None if the archive does contain the module, but has no source for it._get_filename(fullname) -> filename string. Return the filename for the specified module.is_package(fullname) -> bool. Return True if the module specified by fullname is a package. Raise ZipImportError if the module couldn't be found.LEAI`JлI0C7EкE F@ GH`Hb j`?stapsdt Jpythonfunction__return4@-60(%ebp) 4@%esi -4@%eax>stapsdt Jpythonfunction__entry4@-60(%ebp) 4@%esi -4@%eaxlibpython2.6.so.1.0.debug+R.data.rodata.shstrtab.dynamic.note.gnu.build-id.eh_frame.stapsdt.base.gnu.hash.fini.gnu_debuglink.dynsym.gnu.version.rel.dyn.data.rel.ro.gnu.version_r.jcr.eh_frame_hdr.dynstr.probes.ctors.dtors.bss.note.stapsdt.init.rel.plt.got.plt.got.text"$Mo&l ''PW~~6^to o@ HH@   0ȺȺ0@ WP) ?Z5ZZp3   @ JJKJ J]K K